KEGG   Eubacterium limosum: ELI_2938Help
Entry
ELI_2938          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
elm  Eubacterium limosum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ELI_2938
Enzymes [BR:elm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     ELI_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2721985..2723205
Genome map
AA seq 406 aa AA seqDB search
MEFFKQFDMEVFTCGSVACNAKDIEEQAKELKAKGAEIFLGHIPCWTWPNLVVRAAQAMD
MPTVLVANDDPGTHATVGLLGGGGALTQVGIDHVRISSDFEGPKKGLFEKKMMPYIKAAS
AAGRLKGKTFGLFGGRSMGIDTGTFDPMQWKRMFKIDSDHIDHEEIIRRAEVIDEVRIEK
MFDWLTSNVKAVNYNEKFTKEKLKYQIACYFATKDIISDRSLDFAAIKCMPDMTNFRIPQ
CISTAFLNSGYDADGNFEPFAIACEADADAALTMEMMKLLTDGMQTMFADVGHVDYENNL
IFLPNCGSMCTWFAGRHCDGCENLKNVELMMANRPTGGAVTYMNPSPGKITLARLCRNTG
KYEMIIMEAEFVMPNQGIVDGFKKARGIHQLPVAFVHTDGNHPDFW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttggaatttttcaaacaatttgatatggaagtctttacctgcggcagtgtcgcctgtaat
gctaaagacattgaagaacaggcaaaggaattaaaagcaaaaggcgcagaaattttctta
ggacacattccctgctggacttggcctaatttagttgtccgtgccgcacaggccatggat
atgccaacagttttagtcgccaatgacgatccaggaacccatgcgacagttggtcttttg
gggggcggaggtgccctgactcaggtaggcattgaccacgtccgtatcagtagtgatttt
gaaggacctaaaaaaggattatttgaaaaaaaaatgatgccttatattaaggctgccagc
gcagccggccgtttgaagggcaaaactttcggtttgtttggcggacgctctatgggtatt
gatactggaacctttgacccaatgcagtggaagcgcatgtttaaaattgattcagatcac
atcgaccacgaagaaatcatccgtcgggcagaagttattgacgaagtcagaattgaaaaa
atgtttgactggctcacctccaatgtgaaagcagttaattacaatgaaaaatttacaaag
gaaaaattaaagtaccagattgcctgttattttgccacaaaggatattatcagtgaccga
agcctggattttgccgccattaagtgtatgccggatatgactaacttcagaatcccacaa
tgtatttctacagccttcctaaacagcggctacgatgcagacggaaattttgaacccttt
gccattgcctgtgaggcggatgcagacgcagcattgacaatggaaatgatgaagctttta
acggacggaatgcaaactatgtttgcagatgttggacatgtggactatgaaaataatttg
atttttctgccaaattgtggctcgatgtgcacttggttcgcaggacgccactgtgatggc
tgtgaaaacctcaaaaatgttgagttgatgatggcgaatcgtccaactggcggtgcagta
acctacatgaacccatctcccggtaaaattactttggcaaggctttgtagaaatacagga
aaatatgaaatgattatcatggaagctgaattcgttatgccgaatcagggaattgttgat
ggtttcaaaaaagccagaggtatccatcaactaccggtagcttttgttcatactgatggt
aatcatcccgacttttggtaa

DBGET integrated database retrieval system