KEGG   Eubacterium limosum: ELI_2938Help
Entry
ELI_2938          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
elm  Eubacterium limosum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:elm00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2721985..2723205
Genome map
AA seq 406 aa AA seqDB search
MEFFKQFDMEVFTCGSVACNAKDIEEQAKELKAKGAEIFLGHIPCWTWPNLVVRAAQAMD
MPTVLVANDDPGTHATVGLLGGGGALTQVGIDHVRISSDFEGPKKGLFEKKMMPYIKAAS
AAGRLKGKTFGLFGGRSMGIDTGTFDPMQWKRMFKIDSDHIDHEEIIRRAEVIDEVRIEK
MFDWLTSNVKAVNYNEKFTKEKLKYQIACYFATKDIISDRSLDFAAIKCMPDMTNFRIPQ
CISTAFLNSGYDADGNFEPFAIACEADADAALTMEMMKLLTDGMQTMFADVGHVDYENNL
IFLPNCGSMCTWFAGRHCDGCENLKNVELMMANRPTGGAVTYMNPSPGKITLARLCRNTG
KYEMIIMEAEFVMPNQGIVDGFKKARGIHQLPVAFVHTDGNHPDFW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttggaatttttcaaacaatttgatatggaagtctttacctgcggcagtgtcgcctgtaat
gctaaagacattgaagaacaggcaaaggaattaaaagcaaaaggcgcagaaattttctta
ggacacattccctgctggacttggcctaatttagttgtccgtgccgcacaggccatggat
atgccaacagttttagtcgccaatgacgatccaggaacccatgcgacagttggtcttttg
gggggcggaggtgccctgactcaggtaggcattgaccacgtccgtatcagtagtgatttt
gaaggacctaaaaaaggattatttgaaaaaaaaatgatgccttatattaaggctgccagc
gcagccggccgtttgaagggcaaaactttcggtttgtttggcggacgctctatgggtatt
gatactggaacctttgacccaatgcagtggaagcgcatgtttaaaattgattcagatcac
atcgaccacgaagaaatcatccgtcgggcagaagttattgacgaagtcagaattgaaaaa
atgtttgactggctcacctccaatgtgaaagcagttaattacaatgaaaaatttacaaag
gaaaaattaaagtaccagattgcctgttattttgccacaaaggatattatcagtgaccga
agcctggattttgccgccattaagtgtatgccggatatgactaacttcagaatcccacaa
tgtatttctacagccttcctaaacagcggctacgatgcagacggaaattttgaacccttt
gccattgcctgtgaggcggatgcagacgcagcattgacaatggaaatgatgaagctttta
acggacggaatgcaaactatgtttgcagatgttggacatgtggactatgaaaataatttg
atttttctgccaaattgtggctcgatgtgcacttggttcgcaggacgccactgtgatggc
tgtgaaaacctcaaaaatgttgagttgatgatggcgaatcgtccaactggcggtgcagta
acctacatgaacccatctcccggtaaaattactttggcaaggctttgtagaaatacagga
aaatatgaaatgattatcatggaagctgaattcgttatgccgaatcagggaattgttgat
ggtttcaaaaaagccagaggtatccatcaactaccggtagcttttgttcatactgatggt
aatcatcccgacttttggtaa

DBGET integrated database retrieval system