KEGG   Eubacterium limosum: ELI_2984Help
Entry
ELI_2984          CDS       T01336                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
elm  Eubacterium limosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:elm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2755499..2757493
Genome map
AA seq 664 aa AA seqDB search
MSSDNLEILNIDPYLERYKSAIEWRNNRFNMKKKALLKNKKSLSDFADGYLYFGFHQKAE
GWVYREWAPNAKSVFLIGDFNGWDRDATPLKPLGSGRWEVFLPGKKALPHGSRVKVHIKT
KDQSFDRVPLYCKRVIQDKNTFAFDGQIWNPEQPYKWHDKAFHPDQSVPPLIYEAHIGIA
GESPEVSTFKEFTQNTLPHIAGLGYNAVQLMAIMEHPYYASFGYQVSNFFAVSSRFGTPE
DLKALIDTAHHLGIAVILDLVHSHASRNVLDGIGEFDGTDYQFFHAGPEGDHPAWGSKVF
NYDKPEVLHFLLSNIKFWLDEYHFDGFRFDGVTSILYHNHGLGVNFNSYDQYFSSNTDMS
GLTYLQMASALAKEIKPDCFLIAEDMSGLPGMALPVSQGGLGFDYRLGMGLPDFWIHTLR
DLRDEDWDLNALWHELTQRRPGEKVIGYAESHDQAIVGDKTIMFWLADQDMYSDMNVFNQ
NPVIERALALHKMIRLITCTCAGEGYMNFMGNEFGHPEWIDFPREENGWSYQYARRQWHL
AEDTNLRYRYLQDFDRAMIHFVKETKLLEYPSELLLIDTWAKLLLYSKGPYLFAFNFHPT
KDFNGFIPLPDSNGYQPLLNTESRDFGGWMDTEPDLIDAKANCPGRLTTLYIPKRSAAVY
APAR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagataatttagaaattttaaacatagatccctatttagaacgctataaatct
gcaatcgaatggcgaaacaaccggtttaatatgaaaaaaaaggctcttttaaagaataaa
aagagcctttctgattttgcagacggttacctctatttcggctttcaccaaaaggccgag
gggtgggtataccgtgagtgggctccgaacgccaagtctgtttttctcattggtgatttt
aacggatgggacagagacgctacccccctaaagcctttgggcagcggcagatgggaagtc
tttctccccggaaaaaaagcgctgccacatggctcacgggttaaagtacatattaaaacc
aaggatcagtcctttgaccgggtaccgctctactgtaagcgtgtgatacaggataaaaac
acctttgcttttgacgggcagatctggaatcccgaacagccttacaaatggcatgataag
gcctttcaccccgatcaatccgtgccgccgctcatctatgaagctcacatcggcatcgcc
ggagagtctccagaggtctcgaccttcaaagagtttacacaaaacacgctgcctcatatt
gccggacttggctacaatgctgtccagcttatggcgatcatggagcacccttattacgcc
tcctttggctatcaggtttctaatttctttgcggtttcctcccgctttggtactcccgag
gacttaaaggcgctcattgacacagcgcaccatctcggtatcgcggttatcctcgattta
gtgcactcccacgcctcacgcaatgttctggacggtatcggagaatttgacggaacggac
tatcagttttttcacgccggcccggagggcgatcatcctgcctggggttcaaaggttttt
aattacgataagcccgaggttctccattttctcttgtccaatataaaattctggctggac
gaataccattttgacggcttccgttttgacggtgttacctctatactgtaccataaccat
ggccttggcgtaaactttaattcatacgatcagtacttttcatccaatacggatatgtcc
ggtcttacctatctccagatggcttctgcccttgcaaaggaaataaagccggattgtttc
ctcatcgctgaggatatgagcgggcttcccggcatggcacttcccgtctcccagggcggc
cttggctttgactaccggctgggcatgggcctccctgatttctggattcatacattaagg
gatttaagagacgaggactgggatttaaacgcactctggcatgagcttacacagcggcgg
ccgggtgaaaaggtcattggctatgctgaatcacacgatcaagccattgtcggtgataaa
accatcatgttctggctggctgatcaggatatgtacagcgatatgaatgtttttaaccag
aaccctgttattgaacgcgccttggctttacataaaatgatccggctgatcacctgtacc
tgcgctggcgaaggctatatgaactttatgggcaacgagtttgggcatcccgaatggatc
gattttccccgggaggaaaacggctggagctaccagtatgcccgccggcagtggcatctg
gcagaagacaccaaccttcgataccgctatctccaggattttgacagagccatgattcat
tttgtcaaggagacaaagctgcttgaatatccgtctgagcttctgctcattgacacctgg
gcaaaactgctgctctattcaaaggggccttacctcttcgcctttaatttccatcccaca
aaagatttcaatggcttcatcccacttcctgacagcaacggctatcagccccttctcaac
acagaatcccgcgatttcggcggctggatggacacagagcctgacctcattgacgctaag
gcaaactgccccggtcggcttaccaccctatatattccaaaacgctcagccgccgtctac
gccccggcacgctaa

DBGET integrated database retrieval system