KEGG   Eubacterium limosum: ELI_3006Help
Entry
ELI_3006          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elm  Eubacterium limosum
Pathway
elm00260  Glycine, serine and threonine metabolism
elm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01130  Biosynthesis of antibiotics
elm01230  Biosynthesis of amino acids
Module
elm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_3006
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_3006
Enzymes [BR:elm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ELI_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADO37975
UniProt: E3GEW6
Position
complement(2773298..2774677)
Genome map
AA seq 459 aa AA seqDB search
MAKIPYRFYLSEEDLPKQWYNLRADMKEQPDPLINPGTMQPAVESDLYPVFCEKLAHQEM
DGETRYFDIPEPVQEMYRIYRPSPLIRAYNLEKALDTPAKIYYKFEGNNTSGSHKLNSAI
AQVYYAKEQGLTSLTTETGAGQWGTALSEASSYFDIPLTVYMVKVSYEQKPFRKAVMQVF
DGKVVPSPSETTDIGRKILAENPGTTGSLGCAISEAVETAVKTEGCRYVLGSVLNQVLLH
QSIIGLESKKAMEILGEYPDVVIGCAGGGSNLGGLIAPFMQDKLTGKADPRIIAVEPASC
PSLTRGRYAYDFCDTGKITPMAKMYTLGSGFIPSANHAGGLRYHGMSPILSKLYHDGYME
ATSVEQTRVFEAAVYFAKKETILPAPESAHAIRAAMDEALRCKETGEAKTILFGLTGTGY
FDMTAYSAYLEGRMNDYIPSDEDLQKGFDSLPKIPGIQE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataccttaccgtttctatttaagtgaagaggatctgccaaagcagtggtat
aacctgcgggcagatatgaaggagcagccagaccctctgatcaacccaggcaccatgcag
cccgcggtggagtccgacctgtatcctgtattctgtgaaaagctggcgcaccaggaaatg
gatggtgaaacccggtatttcgatattccagaacccgttcaggaaatgtatcgaatctat
cgtccatccccgctgatccgggcctacaacctggaaaaagcgctggataccccggccaaa
atctactacaaatttgaaggcaacaatacctccggcagccataagctcaactcagccatc
gcccaggtgtattacgccaaggagcagggactgaccagcctgacaacagagaccggagcc
ggccagtggggaacagccctctcagaggcaagctcttatttcgatatccccctgaccgtg
tatatggtaaaggtttcctatgaacaaaagcccttcaggaaagccgtgatgcaggtcttt
gacggaaaagtagtgccgagccccagtgaaaccaccgacatcggccgaaaaattttagcg
gaaaacccgggaacaaccggaagcctcggctgcgccatctccgaggccgtggaaaccgca
gtcaaaaccgaaggctgccgctatgtgcttggctctgttctcaatcaggtgctgctgcat
cagtccatcatcggcctcgagagcaaaaaggcaatggagattctgggagaataccccgat
gttgtcattggctgcgctggcggcggttcgaaccttggcggtcttatagcgccgtttatg
caggataagctcaccggaaaagccgatcccagaatcattgccgtcgagcccgcgtcctgt
ccgtcgctgacccgcggccgctacgcctatgatttctgcgatacaggcaagatcaccccg
atggcgaagatgtataccctgggcagcggttttattccatcggccaaccatgccggcggc
ctgcgctaccacgggatgtctccgattttatccaagctgtaccacgacggctatatggaa
gccacctctgtagagcagacccgcgtgtttgaagcagcggtttattttgcaaaaaaagaa
accattctgccagcgcctgaatctgcccacgccatccgcgccgccatggatgaagccctg
cgctgcaaggaaaccggcgaagccaagaccatcctctttggcctgaccggcaccggctat
tttgatatgaccgcctactcagcctaccttgaaggcagaatgaacgactatatcccaagc
gatgaggatctgcagaaaggctttgacagcctgccgaaaatcccggggattcaagagtag

DBGET integrated database retrieval system