KEGG   Eubacterium limosum: ELI_3155Help
Entry
ELI_3155          CDS       T01336                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
elm  Eubacterium limosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_3155
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_3155
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ELI_3155
Enzymes [BR:elm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ELI_3155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903937..2905439
Genome map
AA seq 500 aa AA seqDB search
MKEKYVSTRGGEANVSASEGIIKGIAKDGGLFVPSFIHDIKIDLTALKDATYGELAFEIF
KYFLDDFSDEQIKDCIHNAYYTGKFENEEPVSLKKVDDRYFLELYHGPTCAFKDMALTIL
PYLMTTAMKNADISKDIVILTATSGDTGKAALEGFAKVPHINIVVYYPKDGVSTIQEKQM
LTQDGDNTCVIGVAGNFDDTQNGVKEILNNSGLIEELREQGYVFSSANSINIGRLLPQIV
YYFYSYMQLYKKAVIDLGEAVNFVVPTGNFGNILAGYYARAIGLPVSRLICASNKNNILT
DFFHTGEYNRNRDFYKTMSPSMDILISSNLERLLYDITGGNSEVIADLMNQLSTDGSYAL
ERELLFMGDDHVFYAGCANEEETAGAIKRMFEYNHYLMDPHTAVASKVYSDYRADTGDVE
TPTVILSTASPYKFGRSVYESIFGEVPEGMDDYAVLKELAARTQTEIPVPLRDLDQKENR
HDKVCRPEEMAGCITAFLDK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaatatgtcagcacacgcggaggcgaagcaaacgtgtccgcgtcagaagga
attatcaaaggaatcgccaaggatggcggcttattcgtcccttcattcatccatgacata
aaaattgacctgacagctttgaaggatgcaacctacggagagttggcttttgaaattttc
aaatattttttggacgacttcagtgatgaacagatcaaagactgtatccacaatgcctat
tataccggaaaatttgaaaatgaggaacccgtatcccttaaaaaagtagacgatcgttat
tttcttgagctttaccacggccctacctgcgcgttcaaggatatggcgctgaccattctc
ccctatctgatgacaacggccatgaaaaacgccgatatcagcaaggatatcgtcattctg
accgccacctccggcgatactggaaaggctgccctcgagggctttgccaaagtgccccac
atcaacattgtggtctactatccgaaggacggcgtcagcaccatccaggaaaaacagatg
ctaacccaggatggcgataacacctgcgtcatcggtgtggccggcaactttgacgatacc
cagaacggcgtcaaggaaattctgaacaacagcggcctgatcgaggagctgcgggaacag
ggttatgttttttcctcggccaactccatcaacatcggacgcctgctgccccagattgta
tactatttttacagctacatgcagctctacaaaaaagcagttatcgacctgggagaggct
gtcaactttgtggtgccgaccggtaatttcggaaacattctggccggctactacgcccgt
gccatcggtctgcctgtcagccggctcatctgcgcgtccaataaaaataacatcctgacc
gactttttccacactggtgaatataaccgcaaccgcgatttctataaaaccatgtctcca
tccatggacattctgatctccagcaacctggaacgcctgctctatgacatcacaggcggc
aacagcgaggtgatcgcagacctgatgaaccagttgagcacagacggctcctacgcgctg
gaacgcgagcttctcttcatgggcgacgaccatgttttctatgccggctgcgctaacgag
gaagaaaccgccggggccattaagcgtatgtttgagtataaccattacctcatggaccca
cacactgctgttgccagcaaggtctacagcgactaccgcgcggataccggtgatgtcgag
actccgaccgtcatcctgtccactgccagcccgtacaaatttggccgcagcgtttatgag
agcatcttcggcgaagtgcctgaaggcatggacgattacgcagtgctcaaggagctggcc
gcccggacccaaacggaaatccccgttccgttgagagatctggatcagaaagaaaaccgc
cacgacaaagtttgcaggccggaggaaatggccggctgcatcacagcatttttagacaaa
tag

DBGET integrated database retrieval system