KEGG   Eubacterium limosum: ELI_3366Help
Entry
ELI_3366          CDS       T01336                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
elm  Eubacterium limosum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ELI_3366
Enzymes [BR:elm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ELI_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3125325..3125972
Genome map
AA seq 215 aa AA seqDB search
MRKHCSFYRAVLFVFIFNNLIAFNIGGIQMNKEKIMEAVTMLIEAIGEDPQREGLVDTPD
RIARMYEEIFAGIGQTAEEHLSKSFTIESNDLVIERDIPFYSMCEHHFLPFYGKAHIAYV
PNGKVAGLSKLVRTVDVYARKPQLQEKLTSEIGSAIMEYLDAQGVMVIIEAEHLCMNMRG
VKRPGTKTVTAMSDGILKTDASLKNDVYNLLGIRA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgcggaagcactgctctttttaccgggcagtgctttttgtgtttatttttaataatctt
atagcgttcaatattggaggaatacaaatgaacaaagaaaaaattatggaagctgttacc
atgctgattgaagccatcggcgaagatccccagcgtgagggccttgtagacacacccgac
cgcattgcgagaatgtatgaagaaatctttgccggtatcgggcagacggccgaagaacac
ctgtcaaaatcctttaccattgagtccaatgatcttgtcattgagcgggacatcccgttt
tattccatgtgtgaacatcattttctgcccttctacggaaaagcgcatattgcctatgta
ccaaacggaaaggttgccggcctctctaaactggtaaggactgtggatgtttacgcaagg
aaaccccagcttcaggaaaagctgacctcagaaatcggcagcgccatcatggaatatctg
gacgcccagggcgtaatggtcatcattgaggccgagcacctctgcatgaacatgcgcggt
gtcaagcgccctggtacaaaaaccgtcactgctatgagcgatggtatcttaaagacagac
gccagccttaaaaatgatgtctataatcttttaggaataagagcatga

DBGET integrated database retrieval system