KEGG   Eubacterium limosum: ELI_3368Help
Entry
ELI_3368          CDS       T01336                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
elm  Eubacterium limosum
Pathway
elm00790  Folate biosynthesis
elm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ELI_3368
Enzymes [BR:elm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ELI_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF561 DHquinase_I DUF3531
Motif
Other DBs
NCBI-ProteinID: ADO38328
UniProt: E3GFJ4
Position
3126470..3127276
Genome map
AA seq 268 aa AA seqDB search
MKIGNKDFDLKNQVYIMGILNVTPDSFSDGGRFDSQDEALRHAEEMIEAGADIIDIGGES
TRPSHTPLGEENELKRVIPMIEVIRKHFDIPISIDTYKAKVGEAAIEAGADLINDVWGFK
REPRLAEVAAKHQVPCCLMHNRTNMDYTDLMADILSDLQESIAIALDAGVSKDAIILDPG
IGFAKTSDDNLTVMHHLETLQKLGYPVLLGTSRKSFIGNTLDLPVDERLEGTMATTVVGV
MKGCSIIRVHDVLENRRAALMTAAIMRG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcaataaagattttgatttaaagaaccaagtatatataatggggatttta
aacgttacgcctgattctttttcagacggcggacgttttgattctcaggatgaggctctg
cgccatgccgaggaaatgattgaagccggtgccgatataatcgacattggcggtgaatcc
acaagaccttcccacaccccccttggcgaagaaaatgaattgaaacgcgtcattcctatg
atcgaagtcatcaggaaacactttgacattcccatatcaatcgacacttacaaagcaaaa
gtcggtgaagccgctattgaagctggcgcagacctcatcaatgacgtctggggctttaaa
cgggaaccacgtctggctgaagtagcggcaaagcaccaggttccctgctgtctgatgcac
aaccgtacaaatatggactacacagatctgatggctgatatactcagtgatcttcaggaa
tccatcgccattgccctggatgccggtgtctcaaaagatgccatcatactggatcccgga
attggttttgccaaaaccagcgacgacaatctgaccgtcatgcaccatctggaaacgctt
caaaagctgggctatcctgtacttctcggcacttcacgaaagagctttatcggcaatacc
cttgatcttccggtggatgaacgtctggaaggaaccatggccaccactgttgttggagtg
atgaagggatgctccattattcgtgtgcacgacgtccttgaaaacagacgcgctgctttg
atgaccgcagccatcatgagagggtaa

DBGET integrated database retrieval system