KEGG   Eubacterium limosum: ELI_3368Help
Entry
ELI_3368          CDS       T01336                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
elm  Eubacterium limosum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:elm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3126470..3127276
Genome map
AA seq 268 aa AA seqDB search
MKIGNKDFDLKNQVYIMGILNVTPDSFSDGGRFDSQDEALRHAEEMIEAGADIIDIGGES
TRPSHTPLGEENELKRVIPMIEVIRKHFDIPISIDTYKAKVGEAAIEAGADLINDVWGFK
REPRLAEVAAKHQVPCCLMHNRTNMDYTDLMADILSDLQESIAIALDAGVSKDAIILDPG
IGFAKTSDDNLTVMHHLETLQKLGYPVLLGTSRKSFIGNTLDLPVDERLEGTMATTVVGV
MKGCSIIRVHDVLENRRAALMTAAIMRG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcaataaagattttgatttaaagaaccaagtatatataatggggatttta
aacgttacgcctgattctttttcagacggcggacgttttgattctcaggatgaggctctg
cgccatgccgaggaaatgattgaagccggtgccgatataatcgacattggcggtgaatcc
acaagaccttcccacaccccccttggcgaagaaaatgaattgaaacgcgtcattcctatg
atcgaagtcatcaggaaacactttgacattcccatatcaatcgacacttacaaagcaaaa
gtcggtgaagccgctattgaagctggcgcagacctcatcaatgacgtctggggctttaaa
cgggaaccacgtctggctgaagtagcggcaaagcaccaggttccctgctgtctgatgcac
aaccgtacaaatatggactacacagatctgatggctgatatactcagtgatcttcaggaa
tccatcgccattgccctggatgccggtgtctcaaaagatgccatcatactggatcccgga
attggttttgccaaaaccagcgacgacaatctgaccgtcatgcaccatctggaaacgctt
caaaagctgggctatcctgtacttctcggcacttcacgaaagagctttatcggcaatacc
cttgatcttccggtggatgaacgtctggaaggaaccatggccaccactgttgttggagtg
atgaagggatgctccattattcgtgtgcacgacgtccttgaaaacagacgcgctgctttg
atgaccgcagccatcatgagagggtaa

DBGET integrated database retrieval system