KEGG   Eubacterium limosum: ELI_3521Help
Entry
ELI_3521          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
elm  Eubacterium limosum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:elm00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    ELI_3521
Enzymes [BR:elm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     ELI_3521
Amino acid related enzymes [BR:elm01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   ELI_3521
Transfer RNA biogenesis [BR:elm03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ELI_3521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3284442..3285926)
Genome map
AA seq 494 aa AA seqDB search
MIRDRFAPSPTGNVHVGSLRTALYNYLFAKKNNGQFLLRLEDTDRTRYEEGAVENLLGAL
MVTGVVPDEGLFEEDGKIVQKGDYGPYIQSERLEIYKKYIDQLLENGQAYYCFCTKERLD
EVREKQKRAGETPRYDGHCRNLPREEVEARVAAGEPYVIRLKLPEDHVVTFDDAVRGRIE
INTNDLDDQVLIKTDGFPTYHFAVVVDDHLMGITHVIRGEEWLPSTPKHVYLYECLGWEQ
PQYVHLSNILNDDHKKLSKRQGDVSVGDFLKKGYLPEALINFLALLGWSPEDEQEIFSMD
ELVEAFDLSRINKSGAVFDRAKLDWMNAHYIKELPIEELTARMIPYLVDAGYITEADIEK
RMPWLEKVGELMRERLNYFAQVPEETKVLFDRNFEITDQESLDLLKEETVPVLFNALVEK
ITESDVVDTERAKAILKEIQKEHKAEKIKGKMLYMPTRIMLTGEMHGPDLTLIMDVLGKE
ELLLRLDRMRSMIH
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgattagagatcgttttgctccaagccccactggcaacgtgcatgtgggcagcttgcga
accgccttatacaattatttgtttgccaaaaagaataacggtcagtttttgctgcgcctt
gaagatacagaccgcacccgctacgaagaaggtgcggttgaaaatctgctgggtgctttg
atggtaaccggcgttgtgccggacgaaggcctttttgaggaggacggtaaaattgtccag
aagggtgactacggcccttatatccagtcagaacgtctggaaatttacaaaaagtacatt
gaccagctgctggaaaatgggcaggcttactattgcttttgcacgaaggagcgtctggac
gaagtacgtgaaaagcagaagagggccggtgaaacaccgcgctatgacgggcattgccgc
aacctgcccagagaagaagtggaggctcgtgtcgcagctggcgaaccctacgttatccgt
ctgaaactgccggaagaccacgttgtcacctttgatgacgcagtccgcggcaggattgag
ataaacaccaatgatctggatgatcaggtgttaattaaaaccgacggttttccaacctac
cattttgccgttgtcgtcgatgaccatctcatgggaattacccatgttatccggggcgag
gaatggctgccctccacacccaagcatgtgtacttgtacgaatgcttgggctgggaacag
cctcagtacgttcacttatccaacattctgaatgatgaccataaaaaactcagcaaacgc
cagggcgatgtgtctgtcggtgattttcttaaaaaaggctatcttccggaagctttgatc
aattttctggcccttttaggctggagccctgaggatgagcaggaaatcttttcaatggac
gagctggtcgaagcctttgacctgtccagaatcaataaatccggcgcagtatttgaccgg
gcaaaactggattggatgaacgcccactatatcaaggagcttcccattgaggaactgaca
gcacgcatgattccgtatctggtggacgctggctatatcacggaggcggatattgaaaaa
cgtatgccatggcttgaaaaggttggcgagcttatgcgtgagcggctcaactattttgcg
caggtgccggaagaaacaaaagtgctctttgaccgcaattttgagattacagaccaggaa
agccttgatcttctgaaagaagaaaccgttccggtactctttaatgctttggtcgaaaag
attacagagagtgacgtggtggataccgaacgcgccaaagcgatcctgaaggaaatacag
aaagaacacaaagcagaaaaaataaaagggaaaatgctctacatgcctacccgtatcatg
ttgaccggcgaaatgcacggccccgatttaacactgattatggatgtactcggcaaagaa
gagctgttactgcgtcttgacagaatgcgcagcatgatccattag

DBGET integrated database retrieval system