KEGG   Eubacterium limosum: ELI_3626Help
Entry
ELI_3626          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
elm  Eubacterium limosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ELI_3626
Enzymes [BR:elm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ELI_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3372956..3374479
Genome map
AA seq 507 aa AA seqDB search
MSFKRSSGILMHISSLPGKYGIGTFGKEACSFINLLNKMGFTYWQTLPLGPVDQCHSPYK
SPSAFAGNPFFIDPELLAEEGLLTQDEVKSSEYSDPYSAAYEWLDETRPSLFRKAFSRID
DQIRSDIKIFEDEQRHWLPDYALYMTLKNQFHGKDWYLWEDIGLRDHHTEALKEAREAYA
EEILFHEFLQYEFTKQWNAVKCCANDNGIQIIGDMPIYVSLESADVWAHRDLFDLDPEGQ
PNHIAGVPPDYFCCDGQLWGNPLYNWTAMKTSAYKWWIDRIGRSLEIYDAVRIDHFRGFS
AYWAVAGTAKTARNGKWLEGPGMDFFNAVFNAFDFKEPRIIAEDLGVMDEGVTNLLQETG
FPGMRILQFGFIEEGNNQHLPHNYVENSIAYTGTHDNNTLLGFLWELPPYKRDYALKYIN
YSCSGNEWQEGGPQSPSCHHFIRCLWQSCASLTILPIQDLCGFGGDTKMNCPGCADGNWS
FRITHDALDTIDISWIRSMNEIYKRIP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaacgatcaagcggtatcttaatgcacatttcatcacttcccggtaaatac
ggtatcggaacttttggcaaagaagcctgctcttttatcaatcttttaaataaaatgggc
tttacctactggcagactctgccccttggacccgtagaccagtgccactcgccttataaa
agcccttctgcctttgcgggcaaccctttttttatcgatcctgagctactggctgaggaa
ggcctccttactcaggacgaggtgaaatccagcgaatacagcgacccttacagtgctgcc
tacgaatggcttgatgaaacccggcccagtctctttcgaaaggctttcagccgcattgac
gatcagataagatcggacattaaaatttttgaggacgagcagcgccattggcttccagac
tatgccctctacatgaccttaaaaaaccaattccatgggaaggactggtacctttgggaa
gacataggtcttcgggatcatcacaccgaggcactgaaggaagccagggaagcctatgcc
gaggaaatcctgttccacgagttcctgcagtacgaatttactaaacagtggaatgctgta
aaatgctgcgccaacgacaacggtatccagatcatcggtgacatgcccatctacgtctct
ctggaaagcgccgatgtatgggcacaccgtgatctctttgatcttgacccggagggccag
ccaaatcatattgccggggtaccgccggattatttctgctgcgatgggcagctgtggggt
aatcccctctacaattggacagccatgaagacctctgcctataaatggtggatcgaccgg
attggccgttctcttgagatttacgacgcggttaggattgaccacttcagaggcttttct
gcctattgggctgtggccggcactgctaaaaccgcacgaaacggcaaatggctggaaggt
ccgggcatggattttttcaacgccgtcttcaatgcttttgattttaaggagccgcgcatc
atcgccgaagacttgggcgtaatggatgagggggtcactaatcttctccaggaaaccggc
ttccccggtatgcgtatactgcagtttggctttattgaggaaggtaataaccagcatctg
cctcataattatgtagaaaacagtattgcctacacaggaactcacgataacaacaccctg
ctcggttttttgtgggagcttccaccttacaaacgggattatgctttaaaatatatcaac
tattcctgtagcggcaacgaatggcaggaaggaggcccccaaagcccatcctgccaccat
ttcatccgctgcctgtggcaaagctgcgccagcctcaccattctgcccattcaggatctc
tgcggttttggcggcgacacaaaaatgaactgtcctggctgtgccgatggcaactggagc
tttcggattacccacgatgctctggacaccattgatatctcctggatacgctctatgaac
gaaatatacaagcgcatcccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system