KEGG   Eubacterium limosum: ELI_3657Help
Entry
ELI_3657          CDS       T01336                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
elm  Eubacterium limosum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:elm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3407031..3407642)
Genome map
AA seq 203 aa AA seqDB search
MFEYIKGNYEEQASDYIVVDHQGMGYRINVSANTMSELPKLHKEVKVYIHPAFKEDDVTL
YGFSSKEEREIFRTIITISGIGPKAAMGLLSQFTRDELIRYIVNEDAKAISRAPGIGQKT
ANRIILELKDKYKNFAFTDSAEPGAIENLRETDNLFNEAVNGLLGLGYGYAEASELVEKI
IQPGMSIEDILKNALMSANPLGR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagtatataaaaggcaattatgaggaacaggcgtcagactacatcgttgtggac
catcagggtatgggatatcggatcaatgtttccgcaaacacgatgtctgagcttccaaaa
ttacacaaggaagtaaaggtctatatccatccggcgtttaaggaagatgatgtaacgctc
tatggcttctcgtcaaaagaagaacgcgagattttcagaacaattatcactatttccggc
atcgggccaaaggcagcgatggggctgttatcacagtttaccagagatgagctgattcgc
tatattgtcaacgaggatgccaaggcgatctctcgcgcgccgggaatcggacagaagact
gcgaatcggattattctggagcttaaggataagtacaagaattttgcatttacggattca
gcagaaccgggcgccatcgaaaatctcagagagacggacaacctctttaatgaggcggtt
aacgggctgctgggattgggctatggctatgccgaggcatcagagctggtcgaaaaaatt
attcagccgggaatgagcattgaggatattctgaaaaatgcgctgatgtctgcaaatccc
cttggacggtag

DBGET integrated database retrieval system