KEGG   Eubacterium limosum: ELI_3860Help
Entry
ELI_3860          CDS       T01336                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
elm  Eubacterium limosum
Pathway
elm00521  Streptomycin biosynthesis
elm00523  Polyketide sugar unit biosynthesis
elm01130  Biosynthesis of antibiotics
Module
elm_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ELI_3860
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ELI_3860
Enzymes [BR:elm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ELI_3860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADO38807
UniProt: E3GGK2
Position
complement(3595255..3595815)
Genome map
AA seq 186 aa AA seqDB search
MAAITVTKTQIEGLVIVQPSVFGDERGYFMETYNKEEFEKQGLNMTFIQDNESKSKKGVL
RGLHFQRKYSQGKLVRCTQGAVWDVGVDLRKGSPTYGEWAGVELSAENKTMFYIPEGFAH
GFVVLSDEATFNYKCTNLYAPEYDGGIRWNDPEIGVEWPVEGLELLLSEKDQKQPFLKDI
KDTLEF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcagccataacagtgacaaaaactcagattgaaggactggtaattgttcagccttcc
gtttttggagatgaacgcggttacttcatggaaacctacaataaagaagaatttgaaaag
cagggccttaacatgacttttattcaggacaatgaatcaaagtctaaaaagggtgtgctg
agagggcttcactttcaaagaaaatactcccagggaaaactggtacgctgtacccagggc
gctgtatgggatgtgggagtcgacctgagaaaaggatcgccaacctacggtgagtgggcc
ggtgttgagctgagcgcagaaaataaaaccatgttctacattccagaaggctttgcccat
ggttttgtcgtcttatcagacgaggcgaccttcaattataaatgtacaaatttatacgca
ccggaatacgacggcggtattcgatggaatgacccggaaatcggtgttgaatggcccgtt
gagggcctggaactgctgttatccgaaaaagatcagaaacagccgtttttaaaagatatc
aaggatacgttagaattttaa

DBGET integrated database retrieval system