KEGG   Eubacterium limosum: ELI_3964Help
Entry
ELI_3964          CDS       T01336                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
elm  Eubacterium limosum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ELI_3964
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ELI_3964
Enzymes [BR:elm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ELI_3964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3707998..3709368
Genome map
AA seq 456 aa AA seqDB search
MKRLLSLFLIISASGLLITGCSPALTLSQLFSPVTFTGYVLESDDATLTLLYRAEDAQEP
VTSVFDLTALPQGPLPETGAEVKITLKTGTDPESLKAGDTPLPARKLEVLTASDAAEKAF
YSLRADKLLAGMSLEEKVGQMFFARYPGPAAPEDEKAWQFGGTILFGRDFKDKNPDQIRA
EINACQDAAKIPMLVGVDEEGGDVVRVSGNPALRAESFPSPQTLLQNGGMDAVTADAHEK
DALLKSLVLNVNFAPVCDVSQNPADYIYSRTTGRDAATTADYAKATVSAMDSDGMGSVLK
HFPGYGPGADTHKDFSRDSRPLETFEAQDFLPFKAGIQAGAGSVLVNHNVIEAMDPDHPA
SLSPKVHEILRDALGFDGVILTDDLDMEAITKAYGADTAAVQAVAAGNDMILSSRYTIEI
PAVIEAVKNKTLSEDQINASVKRVLTWKMDLGLIEN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacttttatcactctttttaatcatatccgcctccgggctcctgatcacaggc
tgctcgccggctctcaccctgtcccagctcttttctccggtcacctttacaggctatgtg
ctggaaagcgatgacgccaccctcaccctcctttaccgggctgaggacgcccaggagccc
gtgaccagcgttttcgaccttacagccctcccgcagggccccctgcccgaaaccggcgca
gaggtcaaaatcacgttaaaaaccggcaccgatcccgagagcctaaaggccggggatacc
cctctccccgccagaaaactggaggtcctgacagcttcagacgcggccgaaaaagccttt
tacagcctgcgggcagataagctcctggctggcatgagccttgaggaaaaggtggggcag
atgttctttgcccggtaccccggccctgccgcccccgaggacgaaaaagcctggcagttt
gggggcaccattcttttcgggcgcgactttaaggataaaaaccccgaccaaatccgggcc
gaaatcaacgcctgccaggacgcggcaaagatccctatgctggtgggtgttgacgaggag
ggcggcgacgtggtgcgtgtcagcggcaaccccgcgctccgggccgagagcttcccctct
ccccagaccctgctgcaaaacggcggcatggacgctgtcaccgccgacgctcacgaaaag
gacgcgctgcttaaatccctggtcctcaacgtcaatttcgccccggtctgcgacgtttcg
cagaatcccgcagactacatctactcccggaccaccggaagagacgcagccaccacggcc
gactacgcgaaagccacagtaagcgccatggactcagacggcatgggctctgtgctcaag
cattttccaggctatggccccggcgctgatacccataaggatttctcaagggacagccgc
ccccttgagacctttgaagcccaggattttcttcccttcaaggcaggcatccaggccggc
gcgggcagtgttctggtcaaccacaatgtcattgaggccatggacccggaccacccggca
tccctgtccccaaaggtacacgaaattctgcgggacgcgctgggctttgacggcgttatc
ctcactgacgacctggatatggaggccatcaccaaggcctacggcgccgataccgcggct
gtgcaggcagtggccgccggcaacgacatgattctgagctcccgctataccatcgagatc
cccgcggtgatcgaggctgtaaaaaacaaaaccctctccgaagatcaaatcaatgcctcc
gtcaaacgggtgctcacctggaaaatggacctgggcctcattgaaaattaa

DBGET integrated database retrieval system