KEGG   Eubacterium limosum: ELI_4057Help
Entry
ELI_4057          CDS       T01336                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
elm  Eubacterium limosum
Pathway
elm00900  Terpenoid backbone biosynthesis
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ELI_4057
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ELI_4057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADO38999
UniProt: E3GH44
Position
complement(3775265..3776116)
Genome map
AA seq 283 aa AA seqDB search
MKEYVVRAPAKINLSLDVIGKRPDGYHEMRMVNHSVALSDILVFKENGQRIAVSCSDPKI
PTDARNLVHRVAEKLQARFGIDRGVQIDIQKNIPSEAGLAGGSADAAAAILGLNLIWELN
LSLGEMLAFGSTIGADIPYCCYKGTALVEGIGEVIKPVKPLRKLPVLVVKPQIDIATPWA
FGRLDSAEHVAHPDIDRVIQLVETEDYAALGSAVGNAFEQVVFQDYPEIGEMKAKMLESG
AFASIMSGSGSTVIGYFSDKPAAEKACEAFRRNYFLTFLTEIE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatatgtagtgcgggcgcccgcaaagataaacctttctttggacgttatcggc
aaacgccctgacggttatcatgagatgcgcatggtcaaccattcggtggccttgtcggat
atacttgtgtttaaagaaaacggtcagagaatcgctgtttcctgcagtgatcctaaaatt
ccgacagatgcgcgcaatctggtccatcgggtcgctgaaaagctgcaggcacgttttggc
attgaccggggagtccagatcgacatccagaagaacattccaagtgaagcgggactggct
ggcggcagcgccgacgcggcggcagccattctgggcctgaacctgatctgggagctgaac
ctgagccttggggaaatgctcgctttcggcagcaccatcggcgcggatattccctattgc
tgttataagggaacggcgctggtagaggggatcggtgaggttattaagccggtaaagcct
ttgagaaagctgccggtgctggtagtaaagccccagatagacatcgcgacaccctgggcc
tttggccgtttggacagtgcggagcatgtggcgcacccggatattgaccgcgtcatccag
ctggtagagacagaggattacgcggcccttggcagtgctgtgggcaatgcctttgagcag
gtggttttccaggattatccagagattggcgagatgaaggcgaaaatgctggagtccggc
gctttcgcgtccattatgagcggcagcggttcgacggtgatcggttacttttcagacaag
ccggcggcggagaaggcctgcgaggccttcaggcgtaattattttttaacatttttaact
gaaatagaatag

DBGET integrated database retrieval system