KEGG   Eubacterium limosum: ELI_4323Help
Entry
ELI_4323          CDS       T01336                                 

Definition
(GenBank) transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
elm  Eubacterium limosum
Pathway
elm00010  Glycolysis / Gluconeogenesis
elm00052  Galactose metabolism
elm00500  Starch and sucrose metabolism
elm00520  Amino sugar and nucleotide sugar metabolism
elm00521  Streptomycin biosynthesis
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01120  Microbial metabolism in diverse environments
elm01130  Biosynthesis of antibiotics
elm01200  Carbon metabolism
Module
elm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
elm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_4323
   00052 Galactose metabolism
    ELI_4323
   00500 Starch and sucrose metabolism
    ELI_4323
   00520 Amino sugar and nucleotide sugar metabolism
    ELI_4323
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ELI_4323
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ELI_4323
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ELI_4323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADO39263
UniProt: E3GQH1
Position
complement(4048894..4049841)
Genome map
AA seq 315 aa AA seqDB search
MNIGIDVGGTNLVAGLIGDSGEVFFKKKQPTRAREGYETVLGRIEDLVEQVMAEMRGQSP
ESVGIGVPGIVSADGKTVVSCPNLFWENKPLKRDLEGKIHCPVYLANDATVAGLAENRFG
SSQGCRDAVMFTLGTGVGGSVIVGGRVVNGVHGVASEFGHMIVGDGLYRCNCGKMGCLET
YSSATAVIWLAKKRIEEGCETEILSMAGGDLEAVNAEMVINAAKNGDAVGLECFKSMADH
LAIAISNLVDVLDPEICVLGGGVAHAGTFLLEAVQKSTAERITYKSLVKPEIVLATLEND
AGLVGASCIKEYLYD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcggaatagatgtcggcggtaccaatctggtcgccgggctgatcggagacagc
ggcgaggtgtttttcaagaaaaaacagccgaccagggcaagggagggctatgagactgtc
cttggacgaattgaagacctggtggagcaggtgatggcggagatgagaggacagtcccct
gaaagcgtgggcattggcgtgcctggtatcgtctcagcggacgggaaaaccgtggtgtcc
tgcccgaaccttttctgggaaaataagcctttaaaacgcgatttagagggaaaaattcac
tgcccggtttaccttgccaacgacgccaccgtggctggcctcgcggaaaaccgttttggc
agcagccagggctgccgggatgccgttatgtttactctggggactggcgtgggcggcagt
gtgatcgtgggcggccgggtcgtaaacggcgtgcacggcgtggcctcagagtttgggcac
atgatcgtaggcgacgggctttaccgctgcaactgcggtaaaatgggctgtctggagact
tattcctcagctacggctgtgatctggctggccaaaaaacgcattgaggagggctgtgaa
acggaaattctgtctatggccggaggcgatctggaggcggtcaacgctgagatggtgatc
aatgcggccaaaaacggcgacgcggtgggcctcgaatgctttaagtcgatggcagaccat
ctggccattgcgatttcaaaccttgtggacgttctggaccctgagatctgcgttctgggc
ggcggagtagcccatgcgggcacttttctgctggaggcggtacagaagtccacggcggaa
aggatcacctataagagcctggtgaagcctgagatcgttctggcgacgcttgagaatgac
gcgggcctggtgggagcgtcctgcattaaggaatacctgtacgattaa

DBGET integrated database retrieval system