KEGG   Eubacterium limosum: ELI_4346Help
Entry
ELI_4346          CDS       T01336                                 

Definition
(GenBank) fructose-1-6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
elm  Eubacterium limosum
Pathway
elm00010  Glycolysis / Gluconeogenesis
elm00030  Pentose phosphate pathway
elm00051  Fructose and mannose metabolism
elm00680  Methane metabolism
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01120  Microbial metabolism in diverse environments
elm01130  Biosynthesis of antibiotics
elm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_4346
   00030 Pentose phosphate pathway
    ELI_4346
   00051 Fructose and mannose metabolism
    ELI_4346
  Energy metabolism
   00680 Methane metabolism
    ELI_4346
Enzymes [BR:elm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ELI_4346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADO39285
UniProt: E3GQJ3
Position
4066054..4068126
Genome map
AA seq 690 aa AA seqDB search
MKKAYNGYIHCKGSQKYCENTENFKEHSMENFTKAELEKNKKYLELLSGSFPNITTAVGE
VVNLTAILNLPKSTEHFLTDIHGEHEAFNHVMQNASGAIRRKVMDELGSTVSLEDLEELT
TLIYYPSEKLDLIKKEKKGPYLDNWYELTIYRLVKVCRAAASKYTRSKVRKALPKDFAYV
MEELLQEDEHRFNKKEYYNQIIASLVEYGRAEHFIIEISGVIKRLTTDHLHIIGDIFDRG
PGPDVVMDTLMKHHSLDMQWGNHDILWMGAAAGSAACIANVVRIALRYANMDALETGYGI
NLLPLATFANRVYREDPCQQFTPKVSPDDIETDAEILLMTRMHKAISMIQFKLEDQLISR
HPEYEMDDRLLLRKISEDNKTVEVDGVVYELNDTNFPTLDHEKPWELSEEEQIVVDKLCY
TFRHSEKLQKHIRFMYAKGSMYLVYNNNLLFHACVLLNEDGTFKVKKINNKYYSGRSLMD
KYDQMAREAYFGDIEECPNKSDFLWYLWCNKDSPLFGKDKMATFERYFIDDKTPHKERYT
PFYTRIDDNESIAVMILKEFGVDPVEGHLINGHVPVKAGSGESPIRANGKQLVIDGGFAK
AYQKTTGIAGYTLTYNSYGLTLISHRPFESVDMAIREGVDIKSTRQVVETTLERKRVKDT
DIGKSIQAQVHDLEMLISAYRKGIIKEKSY
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtataatgggtatatacattgcaaaggttcccagaaatattgtgaaaat
acagagaattttaaggagcattctatggaaaactttacaaaagccgagcttgaaaaaaac
aaaaaatatctggagctgctgtccggcagctttccaaacatcaccaccgctgtgggcgag
gtggtaaacctgacggcaattttaaacctgcctaagagcacagagcacttcctgaccgat
atccacggcgagcacgaggcctttaaccacgtgatgcagaacgcctcgggcgccatccgc
cgcaaagtcatggacgagctgggcagcacagtcagccttgaagacctggaagagctgact
acgctcatctattaccccagcgaaaagctggacctcattaaaaaggaaaagaaaggccct
tacctggacaactggtatgagctcaccatttatcgcctggtcaaggtctgccgggccgct
gcctccaaatacacccgttctaaggtgcgcaaggccctgcccaaggatttcgcctatgtg
atggaggagcttttgcaggaggatgagcaccgtttcaacaaaaaggaatactataaccag
attatcgccagcctggtggaatacggccgggccgaacactttatcattgagatttccggg
gtcatcaagcgcctgaccaccgaccatctccacatcatcggggacatctttgaccgtggt
cctgggccggacgtggttatggacaccctcatgaagcaccattccctggatatgcagtgg
ggcaaccacgatattctgtggatgggcgctgccgcgggcagcgcggcctgtatcgccaat
gtggtgcgtatcgctctgcgctacgccaacatggacgccctggaaaccggctacggcatc
aacctgctgcctctggccacctttgcaaaccgcgtgtaccgcgaagacccgtgccagcag
ttcacccccaaggtgagcccggacgacatcgagaccgacgcggaaatcctgctcatgacc
cgcatgcacaaggccatcagcatgatccagtttaagctggaggaccagctgatctcccgc
caccccgaatatgagatggacgaccgcctgctgctgcgcaaaatcagcgaggacaacaag
accgtcgaggtggacggcgtggtctatgagctcaatgacaccaacttccctacccttgac
catgaaaagccctgggaactgagcgaggaagaacagattgtggtggataagctgtgctac
accttccgccacagcgaaaagctccagaagcacatccgcttcatgtacgccaagggcagc
atgtacctggtgtacaacaacaacctgctgttccatgcctgcgtactgctgaacgaggac
ggcacctttaaggttaagaagatcaacaacaaatactattctggccgctccctcatggac
aaatacgaccagatggcccgcgaggcctatttcggcgacattgaggaatgcccgaacaag
tcggacttcctgtggtacctttggtgcaacaaggactccccgcttttcggaaaggataag
atggcgacctttgagcggtatttcatcgacgataaaaccccgcataaggagcgctacacc
ccgttctacaccaggatcgacgacaatgagagcattgcggttatgatcctcaaagagttc
ggcgtggacccggtggaaggccacctgatcaacggccatgtgcctgtaaaagccggctcg
ggcgagagccccatccgcgccaacggcaagcagctggtcatcgacggcggctttgccaaa
gcctaccagaaaaccaccggcatcgccggctataccctgacctacaactcctacggcctc
accctcatcagccaccggccctttgaatcggtcgatatggccatccgcgagggcgtggac
atcaaatccacccgccaggtggtagaaactactctggagcgcaaacgcgtcaaggacacc
gacatcggcaagagcatccaggctcaggtacacgatcttgaaatgctgatctcggcttac
cggaaagggattattaaggagaaatcttattaa

DBGET integrated database retrieval system