KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_00735Help
Entry
NRG857_00735      CDS       T02068                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NRG857_00735
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NRG857_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(162602..163081)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPPLGPQDQPDYLNAAVA
LKTTLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGLSLVEALQAKGFNELDKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatattccagaaagccgcattcttgctgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaatgccgccgtcgcg
ctgaaaaccactcttgcccctgaagagctactcaatcacacacaacgtatcgaattgcag
caaggtcgcgtccgtaaagctgaacgctggggaccgcgcacgctggatctcgacatcatg
ctgtttggtaatgaagtaataaataccgaacgtctgaccgttccgcactacgatatgaaa
aatcgcggctttatgctgtggccactgtttgaaattgcgccggaattggtatttcctgat
ggcttatcattagttgaagctctacaggcaaaaggctttaatgaattagataagtggtaa

DBGET integrated database retrieval system