KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_02995Help
Entry
NRG857_02995      CDS       T02068                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NRG857_02995 (asnB)
Enzymes [BR:eln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NRG857_02995 (asnB)
Peptidases [BR:eln01002]
 Cysteine Peptidases
  Family C44
   NRG857_02995 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657036..658700)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTINEFPAGSY
LWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccatcctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaactcatgtgctggcagtaaacggtgaaatctacaac
caccaggcattgcgcgctgaatatggcgatcgttaccagttccagaccgggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcatatctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacacggtcagctgtatgtggcctca
gaaatgaaagccctcgtgccagtttgccgcacgattaacgagtttccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactacgat
gcggtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggactcc
tcaattatttccgctatcaccaagaaatacgccgcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagttgcactcctttgctgtaggtctgccgggctcaccggat
ctgaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttatgat
gtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgaaggttctgacgaagtgtttggcggttatctatac
ttccacaaagcgccgaacgctaaagagttgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgtgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccacaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgaagcgtat
ctgcctgcaagcgtggcctggcggcaaaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcagcgcagcaggtttctgatcaacagctggaaact
gcccgcttccgcttcccgtacaacacgccgacctcaaaagaagcgtatctgtaccgggag
atctttgaagaattgttcccgcttccgagcgccgctgagtgcgtgccgggcggtccttcc
gtcgcttgttcttccgctaaagcgattgagtgggatgaagcgttcaagaaaatggacgat
ccgtctggtcgcgcggttggcgttcaccagtcggcatataaataa

DBGET integrated database retrieval system