KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_03430Help
Entry
NRG857_03430      CDS       T02068                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NRG857_03430
   00500 Starch and sucrose metabolism
    NRG857_03430
Enzymes [BR:eln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     NRG857_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754195..755478)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYIPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEVQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaacaccgcccgatcaacgtccttctgatcaaaccgcgcctggtacctct
tcgcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgcggcagcgtggaatccttccccgattaccctgcctgcgcaacct
gactttgttgtcggcccggcgggtactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgtaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtgtatatccctgccgctccgggtggaattactctatacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatggtggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccggcgtggtat
atgtacgatagctgccagagtaaacgcagcgacagtatcggtgttctctgctctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaacctgaccatcgaaaacacgctgggc
gatagcgtagatgcgggtaaccatccggcggtggcactgcgtactgatggcgacaaagtg
cagatcaataacgtcaacattctcggtcgtcagaacaccttctttgtcaccaacagcggt
gtgcagaaccgtctggaaacgaatcgtcagccgcgtacgctggtgaccaacagctatatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcccgtacccagcaagaagcgtatgtgtttgcaccggctacgctgtcc
aacatttactacggtttcctcgccgtaaacagccgtttcaatgcttccggtgatggcgtg
gcgcaactgggccgctcgctggatgttgatgccaataccaacggtcaggtagtgatccgt
gatagcgccatcaacgaaggttttaacacagccaaaccgtgggctgatgcggtgatctct
aatcgtccatttgcgggtaacaccggcagcgttgatgataacgacgaagtacagcgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagcaaa
gtggttgcagaggcgaagaagtag

DBGET integrated database retrieval system