KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_05340Help
Entry
NRG857_05340      CDS       T02068                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eln00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:eln00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138625..1139638
Genome map
AA seq 337 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPR
PQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRQELMDSARWKAISARLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaatactggcgcatccg
ctggtgggagggctgattctctttacgcgaaactatcatgatcctgcccagttacgtgaa
ctggtgcgccagatccgcgcagcatcgcgcaatcatctggtggtggcggtagatcaggaa
ggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcggcacaatcattc
gctgcgctgttgggaatggaagaaggcggaaaactggcgcaagaggcaggttggttgatg
gccagcgaaatgattgctatggatattgatatcagctttgcgccagtgctggacgtcggg
catatcagcgcggcgattggcgagcgttcttatcatgccgatccacaaaaagctctggca
attgccagccgttttattgatggtatgcatgaagcgggaatgaaaactaccgggaaacac
ttcccaggtcacggtgcagtaacggcagactcacacaaagaaacaccgtgcgacccacgt
ccgcaagcggagattcgcgctaaagatatgtcggtcttcagttccttaatccgcgaaaat
aaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgatccgcgtccggcg
agcggttctccctactggctgaaaaccgttttgcgtcaggaattgggttttgacggcgtg
attttctctgacgatttatcgatggaaggcgcagcgattatgggcagttatgccgagcgt
ggacaggcatcactggatgcaggttgcgatatgatcctggtctgcaataatcgtaaaggg
gccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgttacacgtttgtat
cataaaggttcattttcgcgacaggaactgatggactcggctcgctggaaagcgatcagc
gcccgtctgaatcagttacatgaacgctggcaggaagagaaggcaggtcattaa

DBGET integrated database retrieval system