KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_06480Help
Entry
NRG857_06480      CDS       T02068                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eln01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eln00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1342067..1343425)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELECAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDNLREALPAHVAIWKALS
VGETLPARDFQHIDKYVFDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcagcaaccgctggccagttttcagaatgagattcagccgagcacacgacatttttat
gatgcgctacagggggcacgcacggcgtttattctggagtgcaaaaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccggcacgcattgctgccatttataaacattac
gcttcggcaatttcagtgctgactgatgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgatcct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgcagccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagtgcgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgcgatttgtcgattgatctcaaccgtacccgcgag
cttgcaccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggctttctgattggttcggcgttgatg
gcccatgacgatttgaacgccgccgtgcgtcgggtgttgctgggtgagaataaagtatgt
ggcctgacacgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcagctg
tatatcgacaatctgcgtgaggctctgccagcacacgtcgccatctggaaggctttaagt
gtcggtgaaactcttcccgcgcgcgattttcagcacatcgataaatatgtattcgacaac
ggtcagggcgggagcggacaacgtttcgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccgggcttgattttaattctgctgtagagtcgcaaccgggtatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system