KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_06720Help
Entry
NRG857_06720      CDS       T02068                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NRG857_06720
Enzymes [BR:eln01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     NRG857_06720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1392218..1393897
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPKTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPENEILALVEV
LQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLRYSVYYKLSHLITLR
RSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITDLHGRDLISE
VDILGNEITLHPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcgact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagt
aatgatttaaagccactacccacatttaatcagttttaccctcaatggctgcaaagaatt
ttttcacatgttcatttattgcctttttatccatggtcatctgatgatggattttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagccatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgatccg
aaaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagcgacgatcaaattgacctc
aattaccgtagccctgaagtgttgctggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagagtatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgtcgcgccaggcacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgaaggcgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcactttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttccttgcctctcacgatggcatc
gggcttaacccactgcgggggttgttgcccgaaaacgaaatattagcgctggtcgaggtg
ttacagcaggaaggggcattagtaaactggaaaaataatcccgacggtacgcgtagcccc
tatgaaatgaatgtcacctatatggatgcgttgagccgccgtgagtgtagcgacgaagaa
cggtgtgccaggtttattctcgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagcattctggggtcgcgtaatgattacgcaggtgtcgaaaaacttgga
tataatcgtgcgattaaccgtaaaaaatactctagtaaagaaataacgacagaactgaac
aataaagcgacattaaggtattcggtatattataagttgtcgcatttaattacacttcgt
cgcagtcataaagagtttcatccggataataatttcaccatcgatgcgattaattcattt
gtaatgcgaattcaaagaagcaatgcggatggcgattgcctgacgggattgtttaatgtc
agcgaaaatattcagcatataaatattactgacctgcacggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacactgcatccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system