KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_07565Help
Entry
NRG857_07565      CDS       T02068                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NRG857_07565 (celA)
Enzymes [BR:eln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     NRG857_07565 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1575445..1576884)
Genome map
AA seq 479 aa AA seqDB search
MSGFKEDFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAGMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIHFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDLNEREQIMYQAVHYELVASALAVQTGKLINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPDDN
AILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFSSHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaagaagattttttatggggcggtgcggtagccgcacatcaattggaa
ggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtaatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacggacttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgggatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctcttcgatgaatgcctgaagcag
ggaatggaacctgtggtgacgctttcgcattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccacttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatctcaatgagcgcgaacaaataatgtaccaggcggtacattatgagttagttgcc
agtgccctggcggtacagactggaaaactgatcaatcctgaatttaatatcggctgtatg
attgctatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcgatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgcaaggaaaggattcaacctcgatatcacaccagatgataac
gcgattcttgccagaggttgtgtcgactttatcggctttagctactacatgtcttttacg
acgcaattttcgccagataatccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccaattgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgattac
ttttcctcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgacttaatt
ggctacaccccgtggggttgcattgacctggtttctgccggaacaggagaaatgaaaaaa
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaacggata
cgtaaagcatcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatatga

DBGET integrated database retrieval system