KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_08915Help
Entry
NRG857_08915      CDS       T02068                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eln00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1840439..1841323
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGIPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDADGVALTFE
LTQSEETKKFWPHDFTLLAHFHVGKTCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtggtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcgggtgaagaagaagttctgtgg
ttgagtaacaacacaccgttcaaaaatggcgtcgccattcgcggtggcataccggtttgc
tggccgtggtttggtccggctgcacaacaaggtctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctgatggtgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggccgcacgactttacgctgttagcgcat
ttccacgtgggtaaaacctgtgaaatcgatcttgaagcacacggcgaatttgaaactacc
tctgctctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtggacta
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgagtgtatctgaatccgcaagattgcagcgtaatt
aatgacgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccaggaccggcgctttcagttagcatgggcgatatgccggatgatggctac
aagacctttgtttgtgtagaaacggcttacgcttcagaaacgcaaaaagtcaccaaagag
aaacctgcacatctggcgcaatccattcgcgttgcgaaacgttaa

DBGET integrated database retrieval system