KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_11850Help
Entry
NRG857_11850      CDS       T02068                                 

Gene name
fadJ
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00071  Fatty acid degradation
eln00280  Valine, leucine and isoleucine degradation
eln00281  Geraniol degradation
eln00310  Lysine degradation
eln00362  Benzoate degradation
eln00380  Tryptophan metabolism
eln00410  beta-Alanine metabolism
eln00640  Propanoate metabolism
eln00650  Butanoate metabolism
eln00903  Limonene and pinene degradation
eln00930  Caprolactam degradation
eln01040  Biosynthesis of unsaturated fatty acids
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01130  Biosynthesis of antibiotics
eln01200  Carbon metabolism
eln01212  Fatty acid metabolism
Module
eln_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NRG857_11850 (fadJ)
   00650 Butanoate metabolism
    NRG857_11850 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    NRG857_11850 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    NRG857_11850 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NRG857_11850 (fadJ)
   00310 Lysine degradation
    NRG857_11850 (fadJ)
   00380 Tryptophan metabolism
    NRG857_11850 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NRG857_11850 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NRG857_11850 (fadJ)
   00281 Geraniol degradation
    NRG857_11850 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NRG857_11850 (fadJ)
   00930 Caprolactam degradation
    NRG857_11850 (fadJ)
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NRG857_11850 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NRG857_11850 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NRG857_11850 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 12878707
NCBI-ProteinID: YP_006120720
UniProt: A0A0H3ELR7
Position
complement(2473899..2476043)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEVLARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAV
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPRGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYCGFAHRDLIIEAVFENLELKQQMVAEVEQNCATHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHASTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERIEHIDTALVKFGFPVGPIQLLDEVG
IDTGTKIMPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYLLIGAQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCDRLVEMSERGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggaatttgcctcgcaggtacgc
gccattattaagcaactccgtgaaaacaaagagttgcgtggcgtggtgtttgtctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagtactggcgcggcaggggcaacagttaatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagttggcg
ctggcgtgccacggtcgtgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggtacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcggta
aagctggggttggtggatgacgtcgttccgcactccatattgctggaagccgctgttgag
ctggcaaagcaggatcgcccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggtaagaaaacagaacacaaaacg
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagcggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggcgctgcgcaatatcttttttgccagtacggacgtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattctaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcggggcataaatcatgcgctgaagtacagttgggatcagcttgagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactattgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgctactcataccatcttt
gcttcgaacacgtcatctttaccgattggcgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgagtacatcggcgcaaaccatcgccaccacggtaaaactggcgaaaaaacag
ggcaaaacgccaattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacatcaatgaagctatccgcatgttgaccgaaggcgagcgtattgagcatatcgat
accgcgctagtgaaatttgggtttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattatgcctgtactggaagctgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggc
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacctgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatataggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgatcgtttagttgagatgagcgag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system