KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_12000Help
Entry
NRG857_12000      CDS       T02068                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00010  Glycolysis / Gluconeogenesis
eln00052  Galactose metabolism
eln00500  Starch and sucrose metabolism
eln00520  Amino sugar and nucleotide sugar metabolism
eln00521  Streptomycin biosynthesis
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01130  Biosynthesis of antibiotics
eln01200  Carbon metabolism
Module
eln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eln_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NRG857_12000 (glk)
   00052 Galactose metabolism
    NRG857_12000 (glk)
   00500 Starch and sucrose metabolism
    NRG857_12000 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NRG857_12000 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NRG857_12000 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NRG857_12000 (glk)
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NRG857_12000 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-GeneID: 12878738
NCBI-ProteinID: YP_006120750
UniProt: A0A0H3ELV3
Structure
PDB: 

Jmol
Position
complement(2513591..2514556)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDMRWVSLPGEGGHVDFAPNSEEEGIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttactgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaagcctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgatatgcgttgggtaagcttgccaggagaaggcggtcac
gttgattttgcgccgaatagtgaagaagagggcattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggccctggactggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggtggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgcgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctctaa

DBGET integrated database retrieval system