KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_13725Help
Entry
NRG857_13725      CDS       T02068                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eln00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2888172..2889947
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVRKPFVVATENDSLNGVAMLMGHQLTGTAQIFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaattggtatccgcccggttattgacggtcgtcgcatg
ggtgttcgtgagtcgcttgaagaacaaacaatgaatatggcgaaagccacggctgcactg
ctgaccgagaaactgcgccatgcctgtggagctgccgtcgagtgtgtcatttccgatacc
tgtatcgcgggtatggctgaagccgctgcttgcgaagaaaaattcagcagtcagaatgta
ggcctcaccattacggtaaccccttgctggtgctatggcagtgaaaccatcgatatggat
ccaacccgcccgaaagccatttggggctttaacggcactgaacgtcccggcgctgtttac
ctggcagcggctctggcagctcacagccagaaaggcatcccggcattctccatttacggt
catgatgttcaggatgccgatgacacatcgattcctgccgatgttgaagaaaaactgctg
cgctttgcccgcgccggtttagcagtcgccagcatgaaaggtaaaagctatctgtcgctg
ggcggcgtttcgatgggtatcgccggttccatcgttgatcacaacttctttgaatcctgg
ctgggaatgaaagtccaggcggtggatatgaccgaactgcgtcgccgtatcgatcagaag
atttacgacgaagccgaactggaaatggcgctggcctgggctgataaaaacttccgctat
ggcgaagatgaaaataacaaacagtatcaacgcaatgccgagcaaagccgcgcagttctg
cgcgaaagtttactgatggcgatgtgtatccgcgacatgatgcaaggcaacagcaaactg
gccgatattggccgcgtggaagaatcacttggctacaacgccatcgctgcaggcttccag
gggcaacgtcactggaccgatcaatatcccaatggcgataccgctgaagcgatcctcaac
agttcatttgactggaatggcgtgcgcaaaccgtttgtcgtggcgaccgaaaacgacagt
cttaacggcgtggcaatgttaatgggccaccagctcaccggcaccgctcagatatttgcc
gatgtccgtacctactggtcaccagaagcaattgagcgtgtaacggggcataaactggac
gggctggcagaacacggcatcatccatttgatcaactccggttctgctgcgctggacggc
tcctgtaaacaacgcgacagcgaaggtaaaccgacgatgaagccgcactgggaaatctct
cagcaagaggctgacgcttgcctcgccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggttactcttcccgcttccttaccgaaggcggcgtcccgttcaccatg
actcgtgtcaacatcatcaaaggcctgggaccggtactgcaaatcgcggaaggctggagc
gtggaattgccgaaggatgtgcatgacatcctcaacaaacgcaccaactcaacctggcca
accacctggtttgcaccgcgcctcaccggtaaagggccgtttacggatgtgtactcggta
atggcgaactggggcgctaaccacggggttctgaccatcggccacgttggcgcagacttt
atcactcttgcctccatgctgcgtatcccggtatgtatgcacaacgttgaagagaccaaa
gtgtatcgtccttctgcctgggccgcgcacggcatggatattgaaggccaggattaccgc
gcttgccagaactacggcccgttgtacaagcgttaa

DBGET integrated database retrieval system