KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_14245Help
Entry
NRG857_14245      CDS       T02068                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eln00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3018777..3020210
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVVPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINPEMKVGCML
AMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttttgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagttgtgcctggcaaatactatcca
aaccatgaagccgttgatttttatggtcactacaaggaggacatcaagctatttgccgaa
atgggcttcaaatgttttcgtacttccatcgcctggacgcgcatttttccaaaaggcgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgatcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgcctctgcatctggtg
cagcaatatggtagctggaccaaccgtaaagtggttgatttctttgtccgtttcgcggaa
gtggtatttgaacgctataagcataaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtgtatacc
gagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagccgcgcatcgcatcaacccggagatgaaagtcggttgtatgctg
gcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgtttgcccaggag
tcgatgcgcgaacgttacgtctttaccgatgtgcagttgcgtggctattacccgtcctat
gtgttgaacgagtgggaacgccgcggatttaacatcaaaatggaagacggcgatctggat
gtactgcgcgaaggcacctgcgattatctcggcttcagctattacatgaccaacgcggtg
aaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccgaacccg
tatgttaaagcgtctgactggggctggcagattgatccggttggtctgcgttacgcgctt
tgcgagctgtatgagcgttaccagaagccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagatgatggcagcatcaatgacgattaccgcattgattacctgcgt
gcccatattgaagagatgaaaaaagcggtgacttacgatggcgtggacctgatgggctac
acgccgtggggctgcatcgactgtgtgtcgttcaccaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattgccagcaacggcgagaatctgtaa

DBGET integrated database retrieval system