KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_15315Help
Entry
NRG857_15315      CDS       T02068                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eln00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eln00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3247642..3250734
Genome map
AA seq 1030 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLSLSGQWNFHFFDHPLQVP
EAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLS
DGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQW
ADSTYVEDQDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDEAYCDATLSCEVVLENLAA
SPVVTTLEYTLFDGEHVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTL
KDADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKD
LQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQW
EKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGH
YVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGPGLKEYKQVIA
PVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQ
ITQPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVPFAPNNARPLTLE
DDRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQ
PNHLQIMQEHLRDFVIEQSDDEVLLVSRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSG
ERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDIWRSTVDAMFENY
PFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAAQHCNELQRSDDI
TLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFF
STNLHSENKQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtac
tttttttcatatgattctgttgcgcaagcgcgtacctttgcccgcgaaaccagcagcctg
tttctgtccttaagcggtcagtggaatttccacttttttgaccatccgctgcaagtgcca
gaagccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtgg
caaatggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccccatcgat
gtgccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagc
gacggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaa
gtctacgttaacggtcagtatgtggggttcagcaagggcagtcgcctgaccgcagagttt
gacatcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgcgtgatgcaatgg
gcggactctacctacgtggaagaccaggatatgtggtggtcggcggggattttccgcgat
gtttatctgatcggaaaacaactcacgcatattaacgatttcaccgttcgtaccgacttt
gacgaagcctattgcgatgccacactttcctgcgaagtggtgctggaaaatctcgccgcc
tcccctgtcgtcacgacgctggaatataccctgtttgatggcgaacacgtggtgcacagc
agcgccattgatcatttggcaattgaaaaactgaccagcgccagttttgcttttactgtc
gaacagccgcagcaatggtcagcagaatccccttatctttaccatctggtcatgacgctg
aaagacgccgacggcaacgttctggaagtggtgccacaacgcgttggcttccgtgatatc
aaagtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcacggcgtcaac
cgccacgacaacgatcatcgcaaaggccgcgccgttgggatggatcgcgtcgagaaagat
ctccagttgatgaagcagcacaacatcaactccgtgcgtaccgctcactacccgaacgat
ccacgtttttacgaactgtgtgatatctatggcctgtttgtgatggcggaaaccgacgtc
gaatcgcacggctttgctaacgtcggcgatatcagccgcattaccgacgatccgcagtgg
gaaaaagtttacgtcgagcgcattgttcgccatattcacgcgcagaaaaaccatccgtcg
atcatcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtac
catgcggcgaaggcgctggatgacacgcgactggtgcattacgaagaagatcgcgatgct
gaagtggtcgatattatttccaccatgtacacccgcgtgcctctgatgaatgagtttggt
gaatacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatggggaacgga
ccgggcgggctgacggagtaccagaacgtcttctataagcacgattgcattcagggacat
tatgtctgggaatggtgcgaccacgggatccaggcgcaggatgacaacggcaacgtctgg
tacaaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggt
ttgatctattccgatcagacgccgggaccaggcctgaaagagtacaaacaggttattgcg
ccggtaaaaatccacgcgctggatctgactcgcggcgagttgaaagtcgaaaataaacta
tggtttaccacgcttgatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaacg
ctcgcgacgcaacagattaaactgcgcgacgttgcgccgaacagcgaagcccccttacag
atcacgcagccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagat
tcccgcacccgctacagcgaagccgggcattctatcgccacttatcagttcccgctgaag
gaaaacaccgcgcagcctgtacctttcgcaccgaataacgcccgtccgctgacgctggaa
gacgatcgtttgagctgtactgttcgcggctacaactttgcgatcaccttctcaaaaacg
agtggtaaaccgacatcctggcaagtgaatggcgagtcgctgctgacccgcgagccaaag
atcaacttcttcaagccgatgatcgacaaccataagcaggagtacgaagggctgtggcag
ccaaatcatttgcagatcatgcaggagcatctgcgcgattttgtcattgagcaaagtgat
gatgaagtgttgctagtcagccgcacggttattgccccaccggtgtttgacttcgggatg
cgctgcacctacatctggcgcatcgctgccgatggccaggttaatgtggcgctttccggc
gaacgttatggcgactatccgcacatcattccgtgcatcggtttcaccatgggaattaac
ggcgaatacgaccaggtggcgtattacggtcgtggaccgggcgaaaactacgccgacagc
cagcaggctaacatcatcgatatctggcgcagcaccgtcgatgccatgttcgagaactat
cccttcccgcagaacaacggtaaccgtcagcatgtccgctggacggcactgactaaccgc
cacggcaacggtctgctggtggttccgcagcgaccaattaacttcagcgcctggcactat
acccaggaaaacatccacgctgcacagcactgtaacgagctgcagcgcagtgatgacatc
actctgaatctcgaccaccagctgcttggcctcggctccaactcctggggcagcgaggtg
ctggactcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtt
tctggcggagaagctaccgcgcaaagcctggcgtcgtatgagttcggcgcagggttcttt
tccacgaatttgcacagcgagaataagcaatga

DBGET integrated database retrieval system