KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_15815Help
Entry
NRG857_15815      CDS       T02068                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eln00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eln00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3353144..3354403)
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcaggggccaacgaagctccagggcgaagtcacaatttccggc
gctaaaaatgctgctctgcctatcctttttgccgcactactggcggaagaaccggtagag
atccagaacgtcccgaaactaaaagacgtcgatacatcaatgaagctgctaagccagctg
ggtgcgaaagtagaacgtaatggttctgtgcatattgatgcccgcgacgttaatgtattc
tgcgcaccttacgatctggttaaaaccatgcgtgcttctatctgggcgctggggccgctg
gtagcgcgctttggtcaggggcaagtttcactgcctggcggttgtacgatcggcgcacgt
ccggttgatctacacatttctggcctcgaacaattaggcgcgaccatcaaactggaagaa
ggttacgttaaagcttccgtcgatggtcgtttgaaaggcgcacatatcgtgatggataaa
gtcagcgttggcgcaacggtgaccatcatgtgtgctgcaacccttgcggaaggcaccacg
attattgaaaacgcagcgcgtgaaccggaaatcgtcgataccgcgaacttcctgattacg
ctgggtgcgaaaattagcggtcagggcaccgatcgtatcgtcatcgaaggtgtggaacgt
ttaggcggcggtgtctatcgtgtgctgccggatcgtatcgaaaccggtactttcctggtg
gcggcggcgatctctcgcggcaaaattatctgccgtaacgcgcagccagatactctggac
gccgtgctggcgaaactgcgtgacgctggagcggacatcgaagtcggcgaagactggatt
agcctggatatgcatggcaaacgtccgaaggctgttaacgtacgtaccgcgccgcatccg
gcattccctaccgatatgcaggcccagttcacgctgttgaatctggtggcagaagggacc
ggattcatcaccgaaacggtctttgaaaaccgctttatgcatgtgccagagctgagccgt
atgggcgcgcacgccgaaatcgaaagcaataccgttatttgtcacggtgttgaaaaactt
tctggcgcacaggttatggcaaccgatctgcgtgcatcagcaagcctggtgctggctggc
tgtattgcggaagggacgacggtggttgatcgtatttatcacatcgatcgtggctacgaa
cgcattgaagacaaactacgcgctttaggtgcaaatattgagcgtgtgaaaggcgagtaa

DBGET integrated database retrieval system