KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17480Help
Entry
NRG857_17480      CDS       T02068                                 

Definition
cytochrome C peroxidase (cpp-like) protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NRG857_17480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3688215..3689612)
Genome map
AA seq 465 aa AA seqDB search
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLANKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKAQFLEVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctcacgtattaccgcgatcggcctggctggcgtcgcgatttgctattta
gggttatctggttatgtgtggtaccacgataataaacgcagtaaacaggccgatgttcag
gcatctgctgtcagtgaaaataataaggttttaggctttctccgcgaaaaaggatgcgat
tattgccatacgccttcggcagaattacctgcctattattatattcccggcgcgaaacag
ttgatggattacgacataaagcttggatataaatcttttaacctcgaggccgtgcgtgcg
gctctgctggctaataaacccgtttcgcaaagcgatctgaataagattgaatgggtgatg
cagtatgaaactatgccgccaacgcgttataccgcgcttcactgggcgggtaaggtgagt
gatgaagagcgggcggaaatactggcctggattgcaaaacagcgcgcggaatattacgcc
agcaatgatactgctccggagcatcgcaatgaaccggtgcagcccatcccgcaaaaactg
cctaccgatgcgcaaaaagtggcgttgggttttgcgctgtatcacgatccccgtttatcg
gctgatagcaccatttcatgcgctcattgccatgcgttgaatgcggggggcgtcgatggc
agaaaaacatcgattggtgttggtggcgcagttgggccgattaacgcgccgacggtattt
aactcagtatttaacgttgagcagttctgggatggtcgtgcggcaacattgcaggatcag
gctggtggaccgccgttgaacccgattgaaatggcgtcgaaatcctgggacgaaattatt
gctaagctggaaaaagatccgcagcttaaagcgcagttcctcgaagtctatccgcaaggt
ttcagtggcgaaaatattactgatgccattgctgaatttgagaaaacattaattacgccg
gattccccatttgataaatggttgcgtggagatgagaatgctctgacggcgcaacagaaa
aaaggctatcaattatttaaagataataaatgtgcaacttgtcatggtggtattattctc
ggcggacgttcctttgaaccgttggggctgaaaaaagactttaactttggtgaaattacg
gcggcggatattggtcgtatgaatgttactaaagaagagcgtgataaattgcgtcagaaa
gtacccggtttacgtaacgttgctttaacggcaccgtacttccatcgcggtgacgtgccg
acgctggacggggcggtgaaactgatgctgcgctatcaggtaggcaaagagctgccgcag
gaggatgtggatgatatcgtcgctttcctgcacagtctgaacggggtttacacgccgtat
atgcaggataaacaataa

DBGET integrated database retrieval system