KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_18880Help
Entry
NRG857_18880      CDS       T02068                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00860  Porphyrin and chlorophyll metabolism
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
Module
eln_M00121  Heme biosynthesis, glutamate => heme
eln_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NRG857_18880 (hemD)
Enzymes [BR:eln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NRG857_18880 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GATase_4
Motif
Other DBs
NCBI-GeneID: 12875881
NCBI-ProteinID: YP_006122118
UniProt: A0A0H3ERY2
Position
complement(4009301..4010041)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPDYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDSLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
TVVVTSGEMLQQLWSLIPQWYREHWLLRCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccgtctcccgcaggagaagagttagtgagccgtctgcgc
acactggggcaggtggcctggcattttccgctgattgagttttctccgggtcgacaatta
ccgcaacttgctgatcaactggcagcgctgggagagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctgcatcagcaagatcgtaaatggccccga
ctacctgattatttcgccattggacgcaccaccgcgctggcactacataccgtaagcgga
cagaagattctctacccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaacgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggattccctgacggcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
acggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacgctgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

DBGET integrated database retrieval system