KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_18965Help
Entry
NRG857_18965      CDS       T02068                                 

Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NRG857_18965
   00565 Ether lipid metabolism
    NRG857_18965
   00590 Arachidonic acid metabolism
    NRG857_18965
   00591 Linoleic acid metabolism
    NRG857_18965
   00592 alpha-Linolenic acid metabolism
    NRG857_18965
Enzymes [BR:eln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NRG857_18965
    3.1.1.32  phospholipase A1
     NRG857_18965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4026742..4027611
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYI
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSDESSPFRETNYEPQLFLGFATDYNFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcaccctttatccttatgacaccaactacatc
atctacacccaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aacgcgcgtaaggatgaagtaaagtttcagttgagcctggcgtttccgctgtggcgtggg
attttaggcccgaactcggtgttgggtgcgtcttatacgcaaaaatcctggtggcagctt
tctaatagcgatgagtcatcaccgtttcgtgaaactaactacgaaccgcaattgttcctc
ggttttgccacggattacaactttgctggctggacgctgcgcgatgtggagatgggttat
aaccacgactcaaacgggcgttcagacccgacttcccgcagctggaaccgcctttatacc
cgcctgatggcagaaaacggtaactggctggtagaggtgaagccgtggtatgtggtgggg
aatacggacgataacccggacatcaccaaatatatgggttactaccagcttaaaattggc
tatcacctcggtgatgcggtactgagcgcgaaagggcagtacaactggaacaccggttac
ggtggtgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagtggttacggcgaatcgctcatcgactataacttcaaccagacccgcgttggt
gtgggagttatgctaaacgacctgttttga

DBGET integrated database retrieval system