KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_19550Help
Entry
NRG857_19550      CDS       T02068                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00010  Glycolysis / Gluconeogenesis
eln00030  Pentose phosphate pathway
eln00051  Fructose and mannose metabolism
eln00052  Galactose metabolism
eln00680  Methane metabolism
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01130  Biosynthesis of antibiotics
eln01200  Carbon metabolism
eln01230  Biosynthesis of amino acids
eln03018  RNA degradation
Module
eln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NRG857_19550
   00030 Pentose phosphate pathway
    NRG857_19550
   00051 Fructose and mannose metabolism
    NRG857_19550
   00052 Galactose metabolism
    NRG857_19550
  Energy metabolism
   00680 Methane metabolism
    NRG857_19550
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NRG857_19550
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NRG857_19550
Protein phosphatases and associated proteins [BR:eln01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NRG857_19550
Messenger RNA biogenesis [BR:eln03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NRG857_19550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-GeneID: 12876178
NCBI-ProteinID: YP_006122252
UniProt: A0A0H3ENP3
Structure
PDB: 

Jmol
Position
4147079..4148137
Genome map
AA seq 352 aa AA seqDB search
MLYYLHIRWITSMCKKTSGNRFHFAFQSSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSA
LTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIE
NLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVV
EAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKA
GIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRM
GAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgttatactatttgcacattcgttggatcacttcgatgtgcaagaagacttccggcaac
agatttcattttgcattccaaagttcagaggtagtcatgattaagaaaatcggtgtgttg
acaagcggcggtgatgcgccaggcatgaacgccgcaattcgcggggttgttcgttctgcg
ctgacagaaggtctggaagtaatgggcatttatgacggctatctgggtctgtatgaagac
cgtatggtacagctagaccgttacagcgtttctgacatgatcaaccgtggtggtacgttc
ctcggttctgcgcgtttcccggaattccgcgacgagaacatccgcgccgtggctatcgaa
aacctgaaaaaacgtgggatcgacgcgctggtggttatcggcggtgacggttcctacatg
ggtgcaatgcgtctgaccgaaatgggcttcccgtgcatcggcctgccgggcactatcgac
aacgacatcaaaggcactgactacactatcggtttcttcactgcgctgagcaccgttgta
gaagcgatcgaccgtctgcgtgacacctcttcttctcaccagcgtatttccgtggtggaa
gtgatgggccgttattgtggcgatctgacgttggctgcggctattgccggcggctgtgaa
ttcgttgtggttccggaagttgaattcagccgtgaagacctggtaaacgaaatcaaagcg
ggtatcgcgaaaggtaaaaaacacgcgatcgtggcgattaccgaacatatgtgtgatgtt
gacgaactggcgcatttcatcgagaaagaaaccggtcgtgaaacccgcgcaactgtgctg
ggccacatccagcgcggtggttctccggtgccttacgaccgtattctggcttcccgtatg
ggcgcttacgctatcgatctgctgctggcaggttacggtggtcgttgcgtaggtatccag
aacgaacagctggttcaccacgacatcatcgacgctatcgaaaacatgaagcgtccgttc
aaaggcgactggctggactgcgcgaaaaaactgtattaa

DBGET integrated database retrieval system