KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_21455Help
Entry
NRG857_21455      CDS       T02068                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eln00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4560267..4561007
Genome map
AA seq 246 aa AA seqDB search
MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVM
NVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagtatgccagcttgcacggaatgcaggcgatgccattatgcaggtctac
gacgggacgaaaccgatggacgtcgtcagcaaagcggacaattctccggtaacggcagcg
gatattgccgctcacaccgttatcatggacggtttacgtacgctgacaccggatattccg
gtcctttctgaagaagatcctcccggttgggaagtccgtcagcactggcagcgttactgg
ctggtagacccgctggatggtactaaagagtttattaaacgtaatggcgaattcaccgtt
aacattgcgctcatcgaccacggtaaaccgattttaggtgtggtgtatgcgccggtaatg
aacgtaatgtacagcgcggcagaaggcaaagcctggaaagaagagtgcggtgtgcgcaag
cagattcaggtccgcgatgcgcgcccgccgctggtggtgatcagccgttcccatgcagat
gcggagctgaaagagtatctgcaacagcttggcgaacatcagaccacgtccatcggctct
tcgctgaaattctgcctggtggcggaaggacaggcgcagctgtacccgcgtttcgggcca
acgaatatttgggataccgccgctggtcatgctgtggctgcagctgccggagcgcacgtt
cacgactggcagggtaaaccgctggattacactccgcgcgagtcgttcctgaatccgggg
ttcagagtgtctatttattaa

DBGET integrated database retrieval system