KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_21660Help
Entry
NRG857_21660      CDS       T02068                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NRG857_21660
   00240 Pyrimidine metabolism
    NRG857_21660
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NRG857_21660
   03430 Mismatch repair
    NRG857_21660
   03440 Homologous recombination
    NRG857_21660
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NRG857_21660
DNA replication proteins [BR:eln03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NRG857_21660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4609065..4609508)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcagttggtgtgtgaaattgccgcagaacgttggcgcagtggtaagcgcgtactc
atcgcctgtgaagatgaaaagcaggcttaccgactggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaagcgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system