KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_21725Help
Entry
NRG857_21725      CDS       T02068                                 

Definition
putative type III restriction-modification system endonuclease protein
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
Enzymes [BR:eln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     NRG857_21725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4625688..4628597
Genome map
AA seq 969 aa AA seqDB search
MSKGFTFEKNLPHQKAGVDSVMNVFVSAIPHQTDHVAIRLLANPELNLSEQQYYNNIKNV
QEFNGIEHSKDNYDAKSNVIDVSMETGTGKTYTYTKTIFDLNKSFGINKFIIIVPTLSIK
AGTVNFLKSDALKEHFRDDYGRELKTYVVESQKSSGKNTKSYMPQAIHDFVEASNFNKKY
IHVLVINSGMINSKSLTDTYDVGLLDNQFDTPFAALSAVKPFIIIDEPHKFPTGKKTWEN
IEKFNAQYIIRYGATFSEGYKNLVYRLTAVDAFNEDLVKGIDAYIEDIVGDGNANLKFVK
SDGKEATFELNENSNKKTFKLVKGESLSKTHSAIHDLTLDALNKSTAVLSNGIELKIGSS
INPYSYDQTLADNMMRKAVKEHFKLEKEYLTQRPRIKPLTLFFIDDIEGYRDGNDIAGSL
KTKFEEYVLAEANELLKIEKDEFYRNYLEKTIKDISSVHGGYFSKDNSDKDDKIEQEINE
ILHDKELLLSLENPRRFIFSKWTLREGWDNPNVFQICKLRSSGSTTSKLQEVGRGLRLPV
NEYMCRVKDRNFTLNYYVDFTEKDFVDSLVKEINDSSFKETVPSKFTQELKDKILSQYPE
LSSRTLMNEIFDDEIIDDNDNFKDSDAYSRLKAKYPAAFPTGVKPSKIKKATDGKRRTKM
RVGKFSELKELWDLINQKAVIEYKINSENEFLSIFKSFMLEETERFTKSGVHTRIDKIYI
YNDTAMSKSIISGDDNFAKLNTMSYREFLDNLSQTIFAKHDTLHKVFCDIKETINITEYL
NIQTIRKIKSGFSKYLLNNSFNKFSLGYNVISGSIHPTKFTNADGEPVNEVLSSDLGILN
DNTKPPLDSYLFEEVFYDSELERLNITDGEIQSVAVFTKIPKNSIKIPVAGGYTYSPDFA
YIVKTIKGDYLNFIIETKNVDGKDSLRLEEERKIKHAQALFSQISKSVKVEFRTQFSTDR
IAEMIKQVG
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagggttcacattcgaaaaaaatttacctcatcaaaaggctggcgttgattcg
gtaatgaatgtctttgtatccgccatacctcatcagacggatcatgttgcaattcgcctg
ttagctaatccagaactgaatctatctgaacaacaatactacaacaacataaaaaatgtt
caggagttcaatggtattgagcactcaaaagataactacgatgctaaaagcaacgtaatt
gatgtttctatggagacaggtacaggtaaaacttatacttacaccaaaacaatttttgac
ctaaacaaatcatttggcattaacaagtttattatcattgttccgactctatcgatcaaa
gccggaaccgttaactttttaaaaagtgatgctttaaaagaacactttcgagatgattac
gggcgtgaactaaagacttacgttgttgaaagtcagaaaagttctggtaaaaatacaaaa
tcatatatgcctcaagctattcatgatttcgtagaagcaagtaattttaataagaaatat
attcacgttcttgtgatcaactcagggatgattaactcaaagtctttaactgacacttat
gatgttggtttgcttgataatcaatttgatacgccatttgctgctcttagtgcggttaaa
ccattcattatcattgatgagcctcataagtttcctactggtaaaaagacatgggaaaat
attgaaaaatttaatgctcaatatatcatccgctatggagcaacctttagtgaaggctat
aagaacttagtttatcgtcttacagccgtagatgcattcaatgaagatcttgttaaaggt
attgatgcatacattgaggatattgttggtgatggtaatgccaacctcaagttcgtcaaa
tctgacggaaaagaagctacatttgaactgaacgaaaatagcaataaaaaaacatttaag
ttagtcaaaggtgaatcactatctaaaacgcatagtgcgatccatgatttaacactggat
gccttaaacaagagcactgctgtattgagtaatggtattgaactaaaaattggtagttca
ataaacccctactcttacgatcagacacttgctgataacatgatgcgtaaagctgtcaaa
gaacactttaagttagaaaaagagtatctgacacaaaggccacgaataaagcctcttact
cttttcttcattgatgatattgaagggtatcgtgatggtaatgatattgccggaagtctg
aaaaccaagtttgaagaatacgtattggcagaagctaatgaactgttaaaaatagagaaa
gatgagttttataggaactaccttgaaaaaactattaaggatatatcttctgttcatggt
ggttatttttcaaaagataatagtgataaagatgataaaattgagcaggaaatcaacgaa
atccttcatgacaaagagcttttattgtctttagaaaatcctcgccgtttcattttctct
aaatggacgttgcgtgaagggtgggataacccaaatgtttttcagatctgtaagctccgt
tcgagcggtagcaccacatctaaacttcaagaggtagggcgtggtttacgtcttccagtg
aatgaatacatgtgtcgtgtgaaagaccgcaattttaccctcaactattatgttgatttt
acagaaaaagattttgtcgattctcttgtcaaagagatcaacgatagttctttcaaagag
actgttccaagtaagtttactcaagagcttaaggataaaatcctatctcaatatccagag
ctttcatccagaacactcatgaatgaaatttttgatgatgagatcatagatgataatgat
aacttcaaagattcagatgcctatagccgcttaaaagccaaatatccggcagcatttcct
acaggagtgaaaccaagcaaaatcaaaaaagccactgatggaaaaagacgcactaaaatg
cgtgttggtaagttcagtgagctgaaagaactatgggatttgatcaatcaaaaagcagtt
attgagtataaaataaatagcgaaaatgaattcttatccattttcaagtcattcatgctc
gaagaaacagaaagatttactaaatcaggcgttcatactcgcattgataaaatttatatc
tataatgatacggcaatgtcgaaaagcattatcagtggtgatgataactttgctaaacta
aacacaatgagctatcgggaatttcttgataacttatcacaaactatttttgctaaacac
gataccttacataaggttttttgtgatataaaagaaactattaatatcactgaatacctg
aacattcaaacaatcagaaagattaaatctggttttagcaagtatttgttgaacaattcg
tttaataaattcagtcttggatataatgtgatctcaggttcaattcatcctacaaagttc
actaatgcagacggtgagcctgtgaatgaggtattatcaagtgatcttggcatattgaat
gacaacacaaaaccacccttggattcttatctttttgaggaagtcttttatgactcagag
cttgaacggctcaacataacagatggagagatccagtctgtagctgtttttacaaagata
ccgaagaactccattaagatcccggtggcaggtggatacacgtactcccctgactttgca
tatattgtcaaaacaataaaaggtgattatttaaactttattatcgaaacaaaaaatgtt
gatggaaaggatagcttaagacttgaagaagaacgtaagataaaacatgcgcaagcatta
tttagtcaaataagtaaatctgttaaagtcgagttcagaacacaattttctacagacaga
atagctgaaatgattaaacaagttggatga

DBGET integrated database retrieval system