KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_30100Help
Entry
NRG857_30100      CDS       T02068                                 

Definition
dihydrofolate reductase type I DhfrA1
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NRG857_30100
   00670 One carbon pool by folate
    NRG857_30100
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NRG857_30100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pO83_CORR:53974..54447
Genome map
AA seq 157 aa AA seqDB search
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVVIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactatcactaatggtagctatatcgaagaatggagttatcgggaatggccctgat
attccatggagtgccaaaggtgaacagctcctgtttaaagctattacctataaccaatgg
ctgttggttggacgcaagacttttgaatcaatgggagcattacccaaccgaaagtatgcg
gtcgtaacacgttcaagttttacatctgacaatgagaacgtagtgatctttccatcaatt
aaagatgctttaaccaacctaaagaaaataacggatcatgtcattgtttcaggtggtggg
gagatatacaaaagcctgatcgatcaagtagatacactacatatatctacaatagacatc
gagccggaaggtgatgtttactttcctgaaatccccagcaattttaggccagtttttacc
caagacttcgcctctaacataaattatagttaccaaatctggcaaaagggttaa

DBGET integrated database retrieval system