KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0303Help
Entry
EC042_0303        CDS       T02067                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00330  Arginine and proline metabolism
elo00332  Carbapenem biosynthesis
elo01100  Metabolic pathways
elo01130  Biosynthesis of antibiotics
elo01230  Biosynthesis of amino acids
Module
elo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EC042_0303 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    EC042_0303 (proB)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EC042_0303 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CBG33135
UniProt: D3GT57
Structure
PDB: 

Jmol
Position
333665..334768
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatattgttgaactcgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggcgcgattgccgccggacgtgagcacctg
ggttacccagaactaccagcgactatcgcctcgaaacaattgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcgatttatggcattcacgtcgggcaa
atgctgctgacccgtgctgatatggaagaccgtgaacgcttcctgaacgcccgcgacacc
ctgcgtgcgttgctcgataacaatatcgttccggtaatcaatgagaacgatgctgtcgct
actgcagagattaaggtcggcgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtacaccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtttacggcattgatgacgcactgcgcgcg
attgccggtgacagtgtttcaggcctcggaactggcggcatgagtaccaaattgcaggcc
gcggacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtgggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgccggcgggtgaaatcacggta
gatgaaggggcaaccgccgccattcttgaacgcggcagctccctgttgccgaaaggtatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgcatttgcaacctcgaaggt
cgcgatatcgcccacggcgtcagtcgttacaacagcgatgcattacgccgtattgccgga
caccactcgcaagaaattgatgcaatactgggatatgaatatggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system