KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0388Help
Entry
EC042_0388        CDS       T02067                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00360  Phenylalanine metabolism
elo00362  Benzoate degradation
elo00620  Pyruvate metabolism
elo00621  Dioxin degradation
elo00622  Xylene degradation
elo00650  Butanoate metabolism
elo01100  Metabolic pathways
elo01120  Microbial metabolism in diverse environments
elo01220  Degradation of aromatic compounds
Module
elo_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EC042_0388 (mhpF)
   00650 Butanoate metabolism
    EC042_0388 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    EC042_0388 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EC042_0388 (mhpF)
   00622 Xylene degradation
    EC042_0388 (mhpF)
   00621 Dioxin degradation
    EC042_0388 (mhpF)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EC042_0388 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CBG33221
UniProt: D3GU48
Position
435781..436731
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLDAN
VEQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcg
ggtgcgcatgtgaaaaacgatgccgctttgcgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccctactgcgtgccggtggttaaccttgatgcgaat
gtcgaacaactgaacgtcaacatggttacctgcggcggccaggccaccattccaatggta
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctattgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcgcgc
gccattgaagtggtgggtggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgatgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaagcggtgcaggcttacgtaccaggttat
cgcctgaaacagcgcgtgcagtttgaagtcatcccgcaggataaaccggttaatttgccg
ggcgtggggcagttctccgggctgaaaacggcggtctggctggaagtcgaaggcgcagca
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system