KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0403Help
Entry
EC042_0403        CDS       T02067                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00860  Porphyrin and chlorophyll metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
Module
elo_M00121  Heme biosynthesis, glutamate => heme
elo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EC042_0403 (hemB)
Enzymes [BR:elo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EC042_0403 (hemB)
Exosome [BR:elo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EC042_0403 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: CBG33236
UniProt: D3GU63
Structure
PDB: 

Jmol
Position
complement(449798..450772)
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRGRTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgccaggcgtgatgcgcattcctgagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atctctcaccataccgatgaaaccggcagcgatgcctggcgggaagatggactggtggcg
cggatgtcgcgcatctgcaagcagaccgtgcctgaaatgatcgtgatgtcagacacctgc
ttttgtgaatacacttctcacggtcactgcggtgtgctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagccgtggttgcagctgctgcaggtgcggac
ttcatcgccccttccgccgcgatggatggtcaggtacaggcgattcgccaggcgctggac
gctgcgggctttaaagatacggcgattatgtcgtattcgaccaagtttgcctcttccttt
tatggcccgttccgcgaagcggcaggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaacccaatgaaccgtcgtgaggcgattcgtgaatcattgctggatgaagcccagggc
gcagactgcctgatggtgaaaccagctggagcgtacctcgacatcgtgcgtgagctgcgt
ggacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtatgcgatgattaag
ttcgccgcgctggcgggtgctatagatgaagagaaagtcgtgctcgaaagcttaggttcg
attaagcgtgcgggtgcggatctgattttcagctactttgcgctggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system