KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0403Help
Entry
EC042_0403        CDS       T02067                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:elo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(449798..450772)
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDIVRELRGRTELPIGAYQVSGEYAMIKFAALAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaatccaacgccctcgtcgcctgcgcaaatctcctgcgctgcgcgctatg
tttgaagagacaacacttagccttaacgacctggtgttgccgatctttgttgaagaagaa
attgacgactacaaagccgttgaagccatgccaggcgtgatgcgcattcctgagaaacat
ctggcacgcgaaattgaacgcatcgccaacgccggtattcgttccgtgatgactttcggc
atctctcaccataccgatgaaaccggcagcgatgcctggcgggaagatggactggtggcg
cggatgtcgcgcatctgcaagcagaccgtgcctgaaatgatcgtgatgtcagacacctgc
ttttgtgaatacacttctcacggtcactgcggtgtgctgtgcgagcatggcgtcgacaac
gacgcgactctggaaaatttaggcaagcaagccgtggttgcagctgctgcaggtgcggac
ttcatcgccccttccgccgcgatggatggtcaggtacaggcgattcgccaggcgctggac
gctgcgggctttaaagatacggcgattatgtcgtattcgaccaagtttgcctcttccttt
tatggcccgttccgcgaagcggcaggaagcgcattaaaaggcgaccgcaaaagctatcag
atgaacccaatgaaccgtcgtgaggcgattcgtgaatcattgctggatgaagcccagggc
gcagactgcctgatggtgaaaccagctggagcgtacctcgacatcgtgcgtgagctgcgt
ggacgtactgaattgccgattggcgcgtatcaggtgagcggtgagtatgcgatgattaag
ttcgccgcgctggcgggtgctatagatgaagagaaagtcgtgctcgaaagcttaggttcg
attaagcgtgcgggtgcggatctgattttcagctactttgcgctggatttggctgagaag
aagattctgcgttaa

DBGET integrated database retrieval system