KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0544Help
Entry
EC042_0544        CDS       T02067                                 

Gene name
tesA
Definition
acyl-coA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EC042_0544 (tesA)
Enzymes [BR:elo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EC042_0544 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     EC042_0544 (tesA)
Lipid biosynthesis proteins [BR:elo01004]
 Fatty acid synthase
  Component type
   EC042_0544 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(613910..614533)
Genome map
AA seq 207 aa AA seqDB search
MNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKT
SVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDV
KAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacaatgttttccgctggcatttgcccttcctgttcctggtcctgttaacc
ttccgtgccgccgcagcggacacgttattgattctgggtgatagcctgagcgccgggtat
cgaatgtctgccagcgcggcctggcctgccttgttgaatgataagtggcagagtaaaacg
tcggtagtcaatgccagcatcagcggcgacacctcgcaacaagggctggcgcgccttccg
gctctgctgaaacagcatcagccgcgctgggtgctggttgaactgggcggcaatgacggt
ttgcgtggttttcagccacagcaaaccgagcaaacgctgcgccagattttgcaggatgtc
aaagccgccaacgctgaaccattgttaatgcaaatacgtctgcctgcaaactatggtcgc
cgttataatgaagcctttagtgccatttaccccaaactcgccaaagagtttgatgttccg
ctgctgcccttttttatggaagaggtctacctcaaaccacaatggatgcaggatgacggt
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgcag
cctttagtaaatcatgactcataa

DBGET integrated database retrieval system