KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0791Help
Entry
EC042_0791        CDS       T02067                                 

Definition
acyl-CoA thioester hydrolase (EC:3.1.2.-)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EC042_0791
   00500 Starch and sucrose metabolism
    EC042_0791
Enzymes [BR:elo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     EC042_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(875771..877054)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWADAVISNRPFAGNTGSVDDSDEIQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaacaccgcccgatcaacgtccttctgatcaaaccgcgcctggtacctct
tctcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgcggcagcgtggaatccttccccgattaccctgcctgcgcaacct
gactttgttgtcggcccggcgggtactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgcaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtatatgtccctgccgctccgggtggaattactctgtacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatgggggcatgagccctgcc
gactggcgtcatgacgtcaacccgcgcggcaaatatatgccaggtaaaccagcgtggtat
atgtacgatagctgccagagcaaacgcagcgacagtatcggcgttctctgctctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaacctgaccatcgaaaacacgctgggc
gatagcgtagatgcaggtaaccatccggcggtggcactgcgtactgatggcgacaaagtg
cagatcaataacgtcaacattctcggtcgtcaaaataccttctttgtcaccaacagtggt
gtgcaaaaccgtctggaaaccaaccgtcagccgcgtactctggtgaccaacagttacatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggctacgctgtct
aacatctattacggtttcctcgccgtaaacagccgtttcaatgcttccggtgatggcgtg
gcgcaactgggtcgttcgctggatgttgatgccaataccaacggtcaggtggtgatccgt
gatagcgccatcaacgaaggttttaacacggcgaaaccgtgggccgatgcggtgatttcc
aatcgtccattcgcaggtaacaccggcagcgttgacgatagcgacgaaatacaacgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagtaaa
gtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system