KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1386Help
Entry
EC042_1386        CDS       T02067                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00260  Glycine, serine and threonine metabolism
elo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01130  Biosynthesis of antibiotics
elo01230  Biosynthesis of amino acids
Module
elo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EC042_1386 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EC042_1386 (trpA)
Enzymes [BR:elo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EC042_1386 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBG34208
UniProt: D3H3G4
Structure
PDB: 

Jmol
Position
complement(1452021..1452827)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVTKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcgctgaaaattatcgacacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcctttgcggcaggtgtgaccccggcacag
tgctttgagatgctggcactgattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagtggaagagtccgctcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgccgaatgccgacgat
gatttgctgcgccagatagcctcctacggtcgtggatacacctatttattgtcacgtgcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggtcacgaagctg
aaagaatacaatgctgcgcctccattgcagggctttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system