KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1774Help
Entry
EC042_1774        CDS       T02067                                 

Definition
(GenBank) putative short chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00670  One carbon pool by folate
elo00790  Folate biosynthesis
elo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EC042_1774
   00670 One carbon pool by folate
    EC042_1774
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EC042_1774
    1.5.1.50  dihydromonapterin reductase
     EC042_1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CBG34601
UniProt: D3GTJ2
Position
1850481..1851203
Genome map
AA seq 240 aa AA seqDB search
MGKAQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLSDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagcccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gcactcgcctggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatccagccattgatggactgattaaggcaggtgcgcagtgtattcaagctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagtacccatggtctgcgt
gctattttgcataacgccagcgcgtggatggcggaaaaaccgggtgcgccactgtccgac
gtgctggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgcta
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcctatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtttccctcttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system