KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1877Help
Entry
EC042_1877        CDS       T02067                                 

Gene name
btuE
Definition
vitamin B12 transport periplasmic protein (putative glutathione peroxidase)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    EC042_1877 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EC042_1877 (btuE)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EC042_1877 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962890..1963441)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYLDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggccgatcgtggttttgtggtg
ctgggattcccgtgcaaccagtttctggagcaagaaccgggcagcgatgaagagattaaa
acttactgcaccactacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggtcgtgcaccgctgtacctt
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcgaaataa

DBGET integrated database retrieval system