KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1888Help
Entry
EC042_1888        CDS       T02067                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EC042_1888 (pfkB)
   01230 Biosynthesis of amino acids
    EC042_1888 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC042_1888 (pfkB)
   00030 Pentose phosphate pathway
    EC042_1888 (pfkB)
   00051 Fructose and mannose metabolism
    EC042_1888 (pfkB)
   00052 Galactose metabolism
    EC042_1888 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    EC042_1888 (pfkB)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EC042_1888 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975548..1976480
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSQDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaagctgcgctgtaccgcaccagtattcgaacccggaggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccattctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggattcgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aatatcgagttggttaagcctaaccaaaaagaactcagtgcgctagtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgagttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcatt
caggttgtgccaccaccggtgaaaagccagagcaccgttggcgctggtgacagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccaagacgat
acacaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system