KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1888Help
Entry
EC042_1888        CDS       T02067                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme 2 (phosphofructokinase-2)
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00010  Glycolysis / Gluconeogenesis
elo00030  Pentose phosphate pathway
elo00051  Fructose and mannose metabolism
elo00052  Galactose metabolism
elo00680  Methane metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
elo01120  Microbial metabolism in diverse environments
elo01130  Biosynthesis of antibiotics
elo01200  Carbon metabolism
elo01230  Biosynthesis of amino acids
Module
elo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC042_1888 (pfkB)
   00030 Pentose phosphate pathway
    EC042_1888 (pfkB)
   00051 Fructose and mannose metabolism
    EC042_1888 (pfkB)
   00052 Galactose metabolism
    EC042_1888 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    EC042_1888 (pfkB)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EC042_1888 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: CBG34714
UniProt: D3GVD6
Structure
PDB: 

Jmol
Position
1975548..1976480
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSQDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaagctgcgctgtaccgcaccagtattcgaacccggaggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccattctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggattcgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aatatcgagttggttaagcctaaccaaaaagaactcagtgcgctagtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaa
cgagttgtcgtttccctgggtccacaaggggcgctgggcgttgatagtgaaaactgcatt
caggttgtgccaccaccggtgaaaagccagagcaccgttggcgctggtgacagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccaagacgat
acacaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system