KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1946Help
Entry
EC042_1946        CDS       T02067                                 

Definition
putative aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC042_1946
Enzymes [BR:elo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EC042_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2035638..2036543
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFGLQGAHLLSWKPA
GEEEILWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHHEDAD
GVALTFELTQSEETKKFWPHDFTLLAHFRVGKTCEIDLEAHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFTDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttggattacagggggcacaccttctctcatggaaacctgcg
ggtgaagaagaaattctgtggttgagtaacaacacaccgttcaaaaatggcgtcgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggctgcacaacaaggcctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcatgaagatgctgat
ggcgtagcgctgacttttgaattgacgcaaagcgaagagacgaaaaaattctggccgcac
gactttacgctgttagcgcatttccgcgtgggtaaaacctgtgaaatcgatcttgaagca
cacggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtgggctgggcgatcgcttcattgataaagtgaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttcactgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggtcac
cagcatcatctgaacgttgtaggctggaatccgggaccggcgctttcagttagcatgggc
gacatgccggacgatggctacaagacctttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtcaccaaagaaaaacctgcacatctggcgcaatccattcgcgttgccaaa
cgttaa

DBGET integrated database retrieval system