KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1946Help
Entry
EC042_1946        CDS       T02067                                 

Definition
putative aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:elo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2035638..2036543
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFGLQGAHLLSWKPA
GEEEILWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHHEDAD
GVALTFELTQSEETKKFWPHDFTLLAHFRVGKTCEIDLEAHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFTDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttggattacagggggcacaccttctctcatggaaacctgcg
ggtgaagaagaaattctgtggttgagtaacaacacaccgttcaaaaatggcgtcgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggctgcacaacaaggcctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcatgaagatgctgat
ggcgtagcgctgacttttgaattgacgcaaagcgaagagacgaaaaaattctggccgcac
gactttacgctgttagcgcatttccgcgtgggtaaaacctgtgaaatcgatcttgaagca
cacggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtgggctgggcgatcgcttcattgataaagtgaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttcactgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggtcac
cagcatcatctgaacgttgtaggctggaatccgggaccggcgctttcagttagcatgggc
gacatgccggacgatggctacaagacctttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtcaccaaagaaaaacctgcacatctggcgcaatccattcgcgttgccaaa
cgttaa

DBGET integrated database retrieval system