KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2049Help
Entry
EC042_2049        CDS       T02067                                 

Gene name
cheB
Definition
Chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:elo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EC042_2049 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    EC042_2049 (cheB)
Enzymes [BR:elo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     EC042_2049 (cheB)
Two-component system [BR:elo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   EC042_2049 (cheB)
Bacterial motility proteins [BR:elo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    EC042_2049 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2140376..2141425)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQSLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcccctgatccgctggtt
gcgcgtgatttgattaagaaattcaatcccgatgtattgacgctggatgttgaaatgccg
cggatggacggattggattttctcgaaaaattaatgcgtttgcgcccaatgcccgttgtg
atggtttcttccctgaccggcaaagggtcagaagtcacgctgcgcgcattggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaagcgagccttgcggcacataaacca
ttgtcggcaccgacaacgctgaaagcggggccgctgttgagttctgaaaaactgattgcg
attggtgcttcaacggggggaactgaggcaattcgtcacgtactgcaatcgttgccgctt
tccagcccggcactgttaattacccagcatatgccgcccggtttcactcgctcttttgcc
gacagacttaataagctttgccagatcggggttaaagaagccgaagacggagaacgtgtc
ttaccggggcatgcctatattgcgccgggcgatcggcatatggagctggcgcgtagtggc
gcaaattaccaaatcaaaattcacgatggcccggcggttaaccgtcatcggccttcggta
gatgtgttgttccattctgtcgccaaacaggcggggcgtaatgcggttggggtgatcctg
accggtatgggcaacgacggtgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagccagcaaatgttggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system