KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2279Help
Entry
EC042_2279        CDS       T02067                                 

Gene name
galF
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00040  Pentose and glucuronate interconversions
elo00052  Galactose metabolism
elo00500  Starch and sucrose metabolism
elo00520  Amino sugar and nucleotide sugar metabolism
elo01100  Metabolic pathways
elo01130  Biosynthesis of antibiotics
Module
elo_M00362  Nucleotide sugar biosynthesis, prokaryotes
elo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EC042_2279 (galF)
   00052 Galactose metabolism
    EC042_2279 (galF)
   00500 Starch and sucrose metabolism
    EC042_2279 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EC042_2279 (galF)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EC042_2279 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CBG35113
UniProt: D3GZA4
Position
complement(2375524..2376417)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGPKFRKSIEKLLGE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtgcagtccatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaacccatttgtcgtggtactgccagacgttgttatcgatgacgccagcgcc
gatccgctacgctataaccttgctgccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcatcgtcgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcacgcaacctggtgcatgggggcgtattcagctgactgat
gctattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgaccggcgacagc
tacgactgcggtaaaaaaatgggctatatgcaggcgtttgtgaagtatggactgcgcaac
ctgaaggaagggccaaagttccgtaagagcattgagaagttgctcggggaatag

DBGET integrated database retrieval system