KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2279Help
Entry
EC042_2279        CDS       T02067                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:elo00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:elo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:elo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:elo00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2375524..2376417)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGPKFRKSIEKLLGE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactactggcggaagtgcagtccatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaacccatttgtcgtggtactgccagacgttgttatcgatgacgccagcgcc
gatccgctacgctataaccttgctgccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcatcgtcgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcacgcaacctggtgcatgggggcgtattcagctgactgat
gctattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgaccggcgacagc
tacgactgcggtaaaaaaatgggctatatgcaggcgtttgtgaagtatggactgcgcaac
ctgaaggaagggccaaagttccgtaagagcattgagaagttgctcggggaatag

DBGET integrated database retrieval system