KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_2581Help
Entry
EC042_2581        CDS       T02067                                 

Gene name
fadJ
Definition
fatty acid oxidation complex alpha subunit [includes: enoyl-CoA hydratase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase] (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:elo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EC042_2581 (fadJ)
   01212 Fatty acid metabolism
    EC042_2581 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EC042_2581 (fadJ)
   00650 Butanoate metabolism
    EC042_2581 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EC042_2581 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EC042_2581 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EC042_2581 (fadJ)
   00310 Lysine degradation
    EC042_2581 (fadJ)
   00380 Tryptophan metabolism
    EC042_2581 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EC042_2581 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EC042_2581 (fadJ)
   00281 Geraniol degradation
    EC042_2581 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    EC042_2581 (fadJ)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EC042_2581 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EC042_2581 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EC042_2581 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2729428..2731572)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFISA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPVPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATECILVVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDRQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGTQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMSKRGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttacccttaatgtccgtctggacaacattgctgttatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgcggcgtggtgtttatctccgcg
aaaccagacaacttcattgctggcgcagacatcaacatgatcggtaactgcaaaacggcg
caagaagcggaagcactggcgcggcagggtcaacagttaatggcggagattcatgctttg
cccgttccggttatcgcggctattcatggcgcttgcctgggtggtgggctggagctggcg
ctggcgtgccacggtcgcgtgtgtactgatgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgtcgttccgcactccattttactggaagccgctgttgag
ctggcaaagcaggatcgtccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
cagggtaactatccggcgacagaatgcatcctggtggttgtcgaaacgggattagcgcaa
ggcaccagtagcggctatgacgctgaagcccgtgcttttggcgaactggcgatgacgccg
caatcgcaggcgctgcgtagtatcttttttgccagtacggaagtgaagaaagatcctggc
agtgatgcgccgcctgcgccattaaacagcgtgggaattttaggtggtggcttgatgggc
ggcggtattgcttacgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacagacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacaaatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgctacgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcggggacatcggcgcaaaccatcgctaccacagtaaaactggcgaaaaaacag
ggtaaaacgccaattgtcgtgcgtgacaaagccgggttttacgtcaatcgcattttagcg
ccttacattaatgaagctatccgcatgttgaccgaaggtgaacgggtagagcacattgat
gccgcgctggtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctgattggcacacaagggcaggggcgactctccgcaccgcaggtagctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggagatattggcgcggtatttggcattggttttccgccatttctcggt
ggtccgttccgctacatcgattctctcggtgcgggtgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttagtcgagatgagcaag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system