KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3104Help
Entry
EC042_3104        CDS       T02067                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3315897..3316607)
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKAATP
ASCDIDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggctttgctcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cctgcgcccgtagctggcatgaagacagttctgactaacagcggtgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagtggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacttgtggttac
tgccacaaactgcatgagcaaatggcagactataacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggatagtgatgcagagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggctggtaaagctgccactccg
gcaagttgcgatatcgatattgccgatcattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gagatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system